klauern
1/22/2018 - 9:25 PM

Manjaro Work Laptop 'binstale' output

Manjaro Work Laptop 'binstale' output

archive/tar
archive/zip
bufio
bytes
cmd/addr2line
cmd/api
cmd/asm
cmd/asm/internal/arch
cmd/asm/internal/asm
cmd/asm/internal/flags
cmd/asm/internal/lex
cmd/cgo
cmd/compile
cmd/compile/internal/amd64
cmd/compile/internal/arm
cmd/compile/internal/arm64
cmd/compile/internal/gc
cmd/compile/internal/mips
cmd/compile/internal/mips64
cmd/compile/internal/ppc64
cmd/compile/internal/s390x
cmd/compile/internal/ssa
cmd/compile/internal/syntax
cmd/compile/internal/test
cmd/compile/internal/types
cmd/compile/internal/x86
cmd/cover
cmd/dist
cmd/doc
cmd/fix
cmd/go
cmd/go/internal/base
cmd/go/internal/bug
cmd/go/internal/buildid
cmd/go/internal/cfg
cmd/go/internal/clean
cmd/go/internal/cmdflag
cmd/go/internal/doc
cmd/go/internal/envcmd
cmd/go/internal/fix
cmd/go/internal/fmtcmd
cmd/go/internal/generate
cmd/go/internal/get
cmd/go/internal/help
cmd/go/internal/list
cmd/go/internal/load
cmd/go/internal/run
cmd/go/internal/str
cmd/go/internal/test
cmd/go/internal/tool
cmd/go/internal/version
cmd/go/internal/vet
cmd/go/internal/web
cmd/go/internal/work
cmd/gofmt
cmd/internal/bio
cmd/internal/browser
cmd/internal/dwarf
cmd/internal/gcprog
cmd/internal/goobj
cmd/internal/obj
cmd/internal/obj/arm
cmd/internal/obj/arm64
cmd/internal/obj/mips
cmd/internal/obj/ppc64
cmd/internal/obj/s390x
cmd/internal/obj/x86
cmd/internal/objabi
cmd/internal/objfile
cmd/internal/src
cmd/internal/sys
cmd/link
cmd/link/internal/amd64
cmd/link/internal/arm
cmd/link/internal/arm64
cmd/link/internal/ld
cmd/link/internal/mips
cmd/link/internal/mips64
cmd/link/internal/ppc64
cmd/link/internal/s390x
cmd/link/internal/x86
cmd/nm
cmd/objdump
cmd/pack
cmd/pprof
cmd/trace
cmd/vet
cmd/vet/internal/cfg
cmd/vet/internal/whitelist
compress/bzip2
compress/flate
compress/gzip
compress/lzw
compress/zlib
container/heap
container/list
container/ring
context
crypto
crypto/aes
crypto/cipher
crypto/des
crypto/dsa
crypto/ecdsa
crypto/elliptic
crypto/hmac
crypto/internal/cipherhw
crypto/md5
crypto/rand
crypto/rc4
crypto/rsa
crypto/sha1
crypto/sha256
crypto/sha512
crypto/subtle
crypto/tls
crypto/x509
crypto/x509/pkix
database/sql
database/sql/driver
debug/dwarf
debug/elf
debug/gosym
debug/macho
debug/pe
debug/plan9obj
encoding
encoding/ascii85
encoding/asn1
encoding/base32
encoding/base64
encoding/binary
encoding/csv
encoding/gob
encoding/hex
encoding/json
encoding/pem
encoding/xml
errors
expvar
flag
fmt
go/ast
go/build
go/constant
go/doc
go/format
go/importer
go/internal/gccgoimporter
go/internal/gcimporter
go/internal/srcimporter
go/parser
go/printer
go/scanner
go/token
go/types
hash
hash/adler32
hash/crc32
hash/crc64
hash/fnv
html
html/template
image
image/color
image/color/palette
image/draw
image/gif
image/internal/imageutil
image/jpeg
image/png
index/suffixarray
internal/cpu
internal/nettrace
internal/poll
internal/race
internal/singleflight
internal/syscall/unix
internal/syscall/windows
internal/syscall/windows/registry
internal/syscall/windows/sysdll
internal/testenv
internal/trace
io
io/ioutil
log
log/syslog
math
math/big
math/bits
math/cmplx
math/rand
mime
mime/multipart
mime/quotedprintable
net
net/http
net/http/cgi
net/http/cookiejar
net/http/fcgi
net/http/httptest
net/http/httptrace
net/http/httputil
net/http/internal
net/http/pprof
net/internal/socktest
net/mail
net/rpc
net/rpc/jsonrpc
net/smtp
net/textproto
net/url
os
os/exec
os/signal
os/user
path
path/filepath
plugin
reflect
regexp
regexp/syntax
runtime
runtime/cgo
runtime/debug
runtime/internal/atomic
runtime/internal/sys
runtime/pprof
runtime/pprof/internal/profile
runtime/race
runtime/trace
sort
strconv
strings
sync
sync/atomic
syscall
testing
testing/internal/testdeps
testing/iotest
testing/quick
text/scanner
text/tabwriter
text/template
text/template/parse
time
unicode
unicode/utf16
unicode/utf8
unsafe
-
-/cmd
bazil.org/fuse
bazil.org/fuse/examples/clockfs
bazil.org/fuse/examples/hellofs
bazil.org/fuse/fs
bazil.org/fuse/fs/bench
bazil.org/fuse/fs/fstestutil
bazil.org/fuse/fs/fstestutil/record
bazil.org/fuse/fuseutil
bazil.org/fuse/syscallx
cloud.google.com/go
cloud.google.com/go/bigquery
cloud.google.com/go/bigquery/datatransfer/apiv1
cloud.google.com/go/bigtable
cloud.google.com/go/bigtable/bttest
cloud.google.com/go/bigtable/cmd/cbt
cloud.google.com/go/bigtable/cmd/emulator
cloud.google.com/go/bigtable/cmd/loadtest
cloud.google.com/go/bigtable/cmd/scantest
cloud.google.com/go/bigtable/internal/cbtconfig
cloud.google.com/go/bigtable/internal/gax
cloud.google.com/go/bigtable/internal/option
cloud.google.com/go/bigtable/internal/stat
cloud.google.com/go/civil
cloud.google.com/go/cmd/go-cloud-debug-agent
cloud.google.com/go/cmd/go-cloud-debug-agent/internal/breakpoints
cloud.google.com/go/cmd/go-cloud-debug-agent/internal/controller
cloud.google.com/go/cmd/go-cloud-debug-agent/internal/valuecollector
cloud.google.com/go/compute/metadata
cloud.google.com/go/container
cloud.google.com/go/container/apiv1
cloud.google.com/go/dataproc/apiv1
cloud.google.com/go/datastore
cloud.google.com/go/debugger/apiv2
cloud.google.com/go/dlp/apiv2beta1
cloud.google.com/go/errorreporting
cloud.google.com/go/errorreporting/apiv1beta1
cloud.google.com/go/firestore
cloud.google.com/go/firestore/apiv1beta1
cloud.google.com/go/firestore/genproto
cloud.google.com/go/firestore/internal
cloud.google.com/go/iam
cloud.google.com/go/iam/admin/apiv1
cloud.google.com/go/internal
cloud.google.com/go/internal/atomiccache
cloud.google.com/go/internal/fields
cloud.google.com/go/internal/optional
cloud.google.com/go/internal/pretty
cloud.google.com/go/internal/protostruct
cloud.google.com/go/internal/readme
cloud.google.com/go/internal/testutil
cloud.google.com/go/internal/tracecontext
cloud.google.com/go/internal/version
cloud.google.com/go/language/apiv1
cloud.google.com/go/language/apiv1beta2
cloud.google.com/go/logging
cloud.google.com/go/logging/apiv2
cloud.google.com/go/logging/internal
cloud.google.com/go/logging/internal/testing
cloud.google.com/go/logging/logadmin
cloud.google.com/go/longrunning
cloud.google.com/go/longrunning/autogen
cloud.google.com/go/monitoring/apiv3
cloud.google.com/go/oslogin/apiv1beta
cloud.google.com/go/profiler
cloud.google.com/go/profiler/busybench
cloud.google.com/go/profiler/mocks
cloud.google.com/go/pubsub
cloud.google.com/go/pubsub/apiv1
cloud.google.com/go/pubsub/internal/distribution
cloud.google.com/go/pubsub/loadtest
cloud.google.com/go/pubsub/loadtest/cmd
cloud.google.com/go/pubsub/loadtest/pb
cloud.google.com/go/pubsub/pstest
cloud.google.com/go/rpcreplay
cloud.google.com/go/rpcreplay/proto/intstore
cloud.google.com/go/rpcreplay/proto/rpcreplay
cloud.google.com/go/spanner
cloud.google.com/go/spanner/admin/database/apiv1
cloud.google.com/go/spanner/admin/instance/apiv1
cloud.google.com/go/spanner/apiv1
cloud.google.com/go/spanner/internal/testutil
cloud.google.com/go/speech/apiv1
cloud.google.com/go/speech/apiv1beta1
cloud.google.com/go/storage
cloud.google.com/go/trace
cloud.google.com/go/trace/apiv1
cloud.google.com/go/trace/apiv2
cloud.google.com/go/translate
cloud.google.com/go/translate/internal/translate/v2
cloud.google.com/go/videointelligence/apiv1
cloud.google.com/go/videointelligence/apiv1beta1
cloud.google.com/go/videointelligence/apiv1beta2
cloud.google.com/go/vision/apiv1
cloud.google.com/go/vision/apiv1p1beta1
code.gitea.io/gitea
code.gitea.io/gitea/cmd
code.gitea.io/gitea/integrations
code.gitea.io/gitea/models
code.gitea.io/gitea/models/migrations
code.gitea.io/gitea/modules/auth
code.gitea.io/gitea/modules/auth/ldap
code.gitea.io/gitea/modules/auth/oauth2
code.gitea.io/gitea/modules/auth/openid
code.gitea.io/gitea/modules/auth/pam
code.gitea.io/gitea/modules/avatar
code.gitea.io/gitea/modules/base
code.gitea.io/gitea/modules/cache
code.gitea.io/gitea/modules/context
code.gitea.io/gitea/modules/cron
code.gitea.io/gitea/modules/highlight
code.gitea.io/gitea/modules/httplib
code.gitea.io/gitea/modules/indexer
code.gitea.io/gitea/modules/lfs
code.gitea.io/gitea/modules/log
code.gitea.io/gitea/modules/mailer
code.gitea.io/gitea/modules/markup
code.gitea.io/gitea/modules/markup/external
code.gitea.io/gitea/modules/markup/markdown
code.gitea.io/gitea/modules/markup/orgmode
code.gitea.io/gitea/modules/minwinsvc
code.gitea.io/gitea/modules/notification
code.gitea.io/gitea/modules/options
code.gitea.io/gitea/modules/private
code.gitea.io/gitea/modules/process
code.gitea.io/gitea/modules/public
code.gitea.io/gitea/modules/search
code.gitea.io/gitea/modules/setting
code.gitea.io/gitea/modules/ssh
code.gitea.io/gitea/modules/sync
code.gitea.io/gitea/modules/templates
code.gitea.io/gitea/modules/test
code.gitea.io/gitea/modules/user
code.gitea.io/gitea/modules/util
code.gitea.io/gitea/modules/validation
code.gitea.io/gitea/routers
code.gitea.io/gitea/routers/admin
code.gitea.io/gitea/routers/api/v1
code.gitea.io/gitea/routers/api/v1/admin
code.gitea.io/gitea/routers/api/v1/convert
code.gitea.io/gitea/routers/api/v1/misc
code.gitea.io/gitea/routers/api/v1/org
code.gitea.io/gitea/routers/api/v1/repo
code.gitea.io/gitea/routers/api/v1/swagger
code.gitea.io/gitea/routers/api/v1/user
code.gitea.io/gitea/routers/api/v1/utils
code.gitea.io/gitea/routers/dev
code.gitea.io/gitea/routers/org
code.gitea.io/gitea/routers/private
code.gitea.io/gitea/routers/repo
code.gitea.io/gitea/routers/routes
code.gitea.io/gitea/routers/user
code.gitea.io/gitea/routers/utils
github.com/360EntSecGroup-Skylar/goreporter
github.com/360EntSecGroup-Skylar/goreporter/engine
github.com/360EntSecGroup-Skylar/goreporter/engine/processbar
github.com/360EntSecGroup-Skylar/goreporter/linters/aligncheck
github.com/360EntSecGroup-Skylar/goreporter/linters/copycheck
github.com/360EntSecGroup-Skylar/goreporter/linters/copycheck/job
github.com/360EntSecGroup-Skylar/goreporter/linters/copycheck/output
github.com/360EntSecGroup-Skylar/goreporter/linters/copycheck/suffixtree
github.com/360EntSecGroup-Skylar/goreporter/linters/copycheck/syntax
github.com/360EntSecGroup-Skylar/goreporter/linters/copycheck/syntax/golang
github.com/360EntSecGroup-Skylar/goreporter/linters/countcode
github.com/360EntSecGroup-Skylar/goreporter/linters/cyclo
github.com/360EntSecGroup-Skylar/goreporter/linters/deadcode
github.com/360EntSecGroup-Skylar/goreporter/linters/depend
github.com/360EntSecGroup-Skylar/goreporter/linters/depth
github.com/360EntSecGroup-Skylar/goreporter/linters/errorcheck
github.com/360EntSecGroup-Skylar/goreporter/linters/errorcheck/test
github.com/360EntSecGroup-Skylar/goreporter/linters/flen
github.com/360EntSecGroup-Skylar/goreporter/linters/gofmt
github.com/360EntSecGroup-Skylar/goreporter/linters/golint
github.com/360EntSecGroup-Skylar/goreporter/linters/golint/golint
github.com/360EntSecGroup-Skylar/goreporter/linters/govet
github.com/360EntSecGroup-Skylar/goreporter/linters/interfacer
github.com/360EntSecGroup-Skylar/goreporter/linters/simplecode
github.com/360EntSecGroup-Skylar/goreporter/linters/simplecode/gotool
github.com/360EntSecGroup-Skylar/goreporter/linters/simplecode/lint
github.com/360EntSecGroup-Skylar/goreporter/linters/simplecode/lint/lintutil
github.com/360EntSecGroup-Skylar/goreporter/linters/simplecode/lint/testutil
github.com/360EntSecGroup-Skylar/goreporter/linters/simplecode/simple
github.com/360EntSecGroup-Skylar/goreporter/linters/simpler
github.com/360EntSecGroup-Skylar/goreporter/linters/simpler/internal/sharedcheck
github.com/360EntSecGroup-Skylar/goreporter/linters/simpler/lint
github.com/360EntSecGroup-Skylar/goreporter/linters/simpler/lint/lintutil
github.com/360EntSecGroup-Skylar/goreporter/linters/simpler/lint/testutil
github.com/360EntSecGroup-Skylar/goreporter/linters/simpler/ssa
github.com/360EntSecGroup-Skylar/goreporter/linters/simpler/ssa/ssautil
github.com/360EntSecGroup-Skylar/goreporter/linters/spellcheck
github.com/360EntSecGroup-Skylar/goreporter/linters/spellcheck/misspell
github.com/360EntSecGroup-Skylar/goreporter/linters/spellcheck/misspell/stringreplacer
github.com/360EntSecGroup-Skylar/goreporter/linters/staticcheck
github.com/360EntSecGroup-Skylar/goreporter/linters/staticcheck/callgraph
github.com/360EntSecGroup-Skylar/goreporter/linters/staticcheck/callgraph/cha
github.com/360EntSecGroup-Skylar/goreporter/linters/staticcheck/callgraph/rta
github.com/360EntSecGroup-Skylar/goreporter/linters/staticcheck/callgraph/static
github.com/360EntSecGroup-Skylar/goreporter/linters/staticcheck/functions
github.com/360EntSecGroup-Skylar/goreporter/linters/staticcheck/gcsizes
github.com/360EntSecGroup-Skylar/goreporter/linters/staticcheck/internal/sharedcheck
github.com/360EntSecGroup-Skylar/goreporter/linters/staticcheck/vrp
github.com/360EntSecGroup-Skylar/goreporter/linters/structcheck
github.com/360EntSecGroup-Skylar/goreporter/linters/unittest
github.com/360EntSecGroup-Skylar/goreporter/linters/varcheck
github.com/360EntSecGroup-Skylar/goreporter/utils
github.com/Azure/azure-sdk-for-go/arm/advisor
github.com/Azure/azure-sdk-for-go/arm/analysisservices
github.com/Azure/azure-sdk-for-go/arm/apimanagement
github.com/Azure/azure-sdk-for-go/arm/apimdeployment
github.com/Azure/azure-sdk-for-go/arm/appinsights
github.com/Azure/azure-sdk-for-go/arm/authorization
github.com/Azure/azure-sdk-for-go/arm/automation
github.com/Azure/azure-sdk-for-go/arm/batch
github.com/Azure/azure-sdk-for-go/arm/billing
github.com/Azure/azure-sdk-for-go/arm/cdn
github.com/Azure/azure-sdk-for-go/arm/cognitiveservices
github.com/Azure/azure-sdk-for-go/arm/commerce
github.com/Azure/azure-sdk-for-go/arm/compute
github.com/Azure/azure-sdk-for-go/arm/consumption
github.com/Azure/azure-sdk-for-go/arm/containerinstance
github.com/Azure/azure-sdk-for-go/arm/containerregistry
github.com/Azure/azure-sdk-for-go/arm/containerservice
github.com/Azure/azure-sdk-for-go/arm/cosmos-db
github.com/Azure/azure-sdk-for-go/arm/customer-insights
github.com/Azure/azure-sdk-for-go/arm/datalake-analytics/account
github.com/Azure/azure-sdk-for-go/arm/datalake-store/account
github.com/Azure/azure-sdk-for-go/arm/deployment
github.com/Azure/azure-sdk-for-go/arm/devtestlabs
github.com/Azure/azure-sdk-for-go/arm/disk
github.com/Azure/azure-sdk-for-go/arm/dns
github.com/Azure/azure-sdk-for-go/arm/documentdb
github.com/Azure/azure-sdk-for-go/arm/eventgrid
github.com/Azure/azure-sdk-for-go/arm/eventhub
github.com/Azure/azure-sdk-for-go/arm/examples/check
github.com/Azure/azure-sdk-for-go/arm/examples/create
github.com/Azure/azure-sdk-for-go/arm/examples/dns
github.com/Azure/azure-sdk-for-go/arm/examples/dns/paging
github.com/Azure/azure-sdk-for-go/arm/examples/helpers
github.com/Azure/azure-sdk-for-go/arm/graphrbac
github.com/Azure/azure-sdk-for-go/arm/hdinsight
github.com/Azure/azure-sdk-for-go/arm/insights
github.com/Azure/azure-sdk-for-go/arm/intune
github.com/Azure/azure-sdk-for-go/arm/iothub
github.com/Azure/azure-sdk-for-go/arm/keyvault
github.com/Azure/azure-sdk-for-go/arm/logic
github.com/Azure/azure-sdk-for-go/arm/machinelearning/commitmentplans
github.com/Azure/azure-sdk-for-go/arm/machinelearning/webservices
github.com/Azure/azure-sdk-for-go/arm/marketplaceordering
github.com/Azure/azure-sdk-for-go/arm/mediaservices
github.com/Azure/azure-sdk-for-go/arm/mobileengagement
github.com/Azure/azure-sdk-for-go/arm/monitor
github.com/Azure/azure-sdk-for-go/arm/mysql
github.com/Azure/azure-sdk-for-go/arm/network
github.com/Azure/azure-sdk-for-go/arm/networkwatcher
github.com/Azure/azure-sdk-for-go/arm/notificationhubs
github.com/Azure/azure-sdk-for-go/arm/operationalinsights
github.com/Azure/azure-sdk-for-go/arm/operationsmanagement
github.com/Azure/azure-sdk-for-go/arm/postgresql
github.com/Azure/azure-sdk-for-go/arm/powerbiembedded
github.com/Azure/azure-sdk-for-go/arm/recoveryservices
github.com/Azure/azure-sdk-for-go/arm/recoveryservicesbackup
github.com/Azure/azure-sdk-for-go/arm/recoveryservicessiterecovery
github.com/Azure/azure-sdk-for-go/arm/redis
github.com/Azure/azure-sdk-for-go/arm/relay
github.com/Azure/azure-sdk-for-go/arm/resourcehealth
github.com/Azure/azure-sdk-for-go/arm/resources/features
github.com/Azure/azure-sdk-for-go/arm/resources/links
github.com/Azure/azure-sdk-for-go/arm/resources/locks
github.com/Azure/azure-sdk-for-go/arm/resources/managedapplications
github.com/Azure/azure-sdk-for-go/arm/resources/policy
github.com/Azure/azure-sdk-for-go/arm/resources/resources
github.com/Azure/azure-sdk-for-go/arm/resources/subscriptions
github.com/Azure/azure-sdk-for-go/arm/scheduler
github.com/Azure/azure-sdk-for-go/arm/search
github.com/Azure/azure-sdk-for-go/arm/servermanagement
github.com/Azure/azure-sdk-for-go/arm/service-map
github.com/Azure/azure-sdk-for-go/arm/servicebus
github.com/Azure/azure-sdk-for-go/arm/servicefabric
github.com/Azure/azure-sdk-for-go/arm/sql
github.com/Azure/azure-sdk-for-go/arm/storage
github.com/Azure/azure-sdk-for-go/arm/storageimportexport
github.com/Azure/azure-sdk-for-go/arm/storsimple8000series
github.com/Azure/azure-sdk-for-go/arm/streamanalytics
github.com/Azure/azure-sdk-for-go/arm/trafficmanager
github.com/Azure/azure-sdk-for-go/arm/visualstudio
github.com/Azure/azure-sdk-for-go/arm/web
github.com/Azure/azure-sdk-for-go/datalake-store/filesystem
github.com/Azure/azure-sdk-for-go/dataplane/cognitiveservices/face
github.com/Azure/azure-sdk-for-go/dataplane/cognitiveservices/textanalytics
github.com/Azure/azure-sdk-for-go/dataplane/keyvault
github.com/Azure/azure-sdk-for-go/management
github.com/Azure/azure-sdk-for-go/management/affinitygroup
github.com/Azure/azure-sdk-for-go/management/hostedservice
github.com/Azure/azure-sdk-for-go/management/location
github.com/Azure/azure-sdk-for-go/management/networksecuritygroup
github.com/Azure/azure-sdk-for-go/management/osimage
github.com/Azure/azure-sdk-for-go/management/sql
github.com/Azure/azure-sdk-for-go/management/storageservice
github.com/Azure/azure-sdk-for-go/management/testutils
github.com/Azure/azure-sdk-for-go/management/virtualmachine
github.com/Azure/azure-sdk-for-go/management/virtualmachinedisk
github.com/Azure/azure-sdk-for-go/management/virtualmachineimage
github.com/Azure/azure-sdk-for-go/management/virtualnetwork
github.com/Azure/azure-sdk-for-go/management/vmutils
github.com/Azure/azure-sdk-for-go/profiles/2017-03-09/compute/mgmt/compute
github.com/Azure/azure-sdk-for-go/profiles/2017-03-09/network/mgmt/network
github.com/Azure/azure-sdk-for-go/profiles/2017-03-09/resources/mgmt/features
github.com/Azure/azure-sdk-for-go/profiles/2017-03-09/resources/mgmt/links
github.com/Azure/azure-sdk-for-go/profiles/2017-03-09/resources/mgmt/locks
github.com/Azure/azure-sdk-for-go/profiles/2017-03-09/resources/mgmt/policy
github.com/Azure/azure-sdk-for-go/profiles/2017-03-09/resources/mgmt/resources
github.com/Azure/azure-sdk-for-go/profiles/2017-03-09/resources/mgmt/subscriptions
github.com/Azure/azure-sdk-for-go/profiles/2017-03-09/storage/mgmt/storage
github.com/Azure/azure-sdk-for-go/profiles/latest/advisor/mgmt/advisor
github.com/Azure/azure-sdk-for-go/profiles/latest/analysisservices/mgmt/analysisservices
github.com/Azure/azure-sdk-for-go/profiles/latest/appinsights/mgmt/insights
github.com/Azure/azure-sdk-for-go/profiles/latest/authorization/mgmt/authorization
github.com/Azure/azure-sdk-for-go/profiles/latest/automation/mgmt/automation
github.com/Azure/azure-sdk-for-go/profiles/latest/batch/batch
github.com/Azure/azure-sdk-for-go/profiles/latest/batch/mgmt/batch
github.com/Azure/azure-sdk-for-go/profiles/latest/cdn/mgmt/cdn
github.com/Azure/azure-sdk-for-go/profiles/latest/cognitiveservices/computervision
github.com/Azure/azure-sdk-for-go/profiles/latest/cognitiveservices/contentmoderator
github.com/Azure/azure-sdk-for-go/profiles/latest/cognitiveservices/customsearch
github.com/Azure/azure-sdk-for-go/profiles/latest/cognitiveservices/entitysearch
github.com/Azure/azure-sdk-for-go/profiles/latest/cognitiveservices/face
github.com/Azure/azure-sdk-for-go/profiles/latest/cognitiveservices/imagesearch
github.com/Azure/azure-sdk-for-go/profiles/latest/cognitiveservices/luis/runtime
github.com/Azure/azure-sdk-for-go/profiles/latest/cognitiveservices/mgmt/cognitiveservices
github.com/Azure/azure-sdk-for-go/profiles/latest/cognitiveservices/newssearch
github.com/Azure/azure-sdk-for-go/profiles/latest/cognitiveservices/spellcheck
github.com/Azure/azure-sdk-for-go/profiles/latest/cognitiveservices/textanalytics
github.com/Azure/azure-sdk-for-go/profiles/latest/cognitiveservices/videosearch
github.com/Azure/azure-sdk-for-go/profiles/latest/cognitiveservices/websearch
github.com/Azure/azure-sdk-for-go/profiles/latest/compute/mgmt/compute
github.com/Azure/azure-sdk-for-go/profiles/latest/containerregistry/mgmt/containerregistry
github.com/Azure/azure-sdk-for-go/profiles/latest/containerservice/mgmt/containerservice
github.com/Azure/azure-sdk-for-go/profiles/latest/cosmos-db/mgmt/documentdb
github.com/Azure/azure-sdk-for-go/profiles/latest/customerinsights/mgmt/customerinsights
github.com/Azure/azure-sdk-for-go/profiles/latest/datalake/analytics/job
github.com/Azure/azure-sdk-for-go/profiles/latest/datalake/analytics/mgmt/account
github.com/Azure/azure-sdk-for-go/profiles/latest/datalake/store/filesystem
github.com/Azure/azure-sdk-for-go/profiles/latest/datalake/store/mgmt/account
github.com/Azure/azure-sdk-for-go/profiles/latest/devtestlabs/mgmt/dtl
github.com/Azure/azure-sdk-for-go/profiles/latest/dns/mgmt/dns
github.com/Azure/azure-sdk-for-go/profiles/latest/domainservices/mgmt/aad
github.com/Azure/azure-sdk-for-go/profiles/latest/eventgrid/eventgrid
github.com/Azure/azure-sdk-for-go/profiles/latest/eventhub/mgmt/eventhub
github.com/Azure/azure-sdk-for-go/profiles/latest/graphrbac/graphrbac
github.com/Azure/azure-sdk-for-go/profiles/latest/iothub/mgmt/devices
github.com/Azure/azure-sdk-for-go/profiles/latest/keyvault/keyvault
github.com/Azure/azure-sdk-for-go/profiles/latest/keyvault/mgmt/keyvault
github.com/Azure/azure-sdk-for-go/profiles/latest/logic/mgmt/logic
github.com/Azure/azure-sdk-for-go/profiles/latest/machinelearning/mgmt/webservices
github.com/Azure/azure-sdk-for-go/profiles/latest/marketplaceordering/mgmt/marketplaceordering
github.com/Azure/azure-sdk-for-go/profiles/latest/mediaservices/mgmt/media
github.com/Azure/azure-sdk-for-go/profiles/latest/mobileengagement/mgmt/mobileengagement
github.com/Azure/azure-sdk-for-go/profiles/latest/network/mgmt/network
github.com/Azure/azure-sdk-for-go/profiles/latest/notificationhubs/mgmt/notificationhubs
github.com/Azure/azure-sdk-for-go/profiles/latest/operationalinsights/mgmt/operationalinsights
github.com/Azure/azure-sdk-for-go/profiles/latest/powerbiembedded/mgmt/powerbiembedded
github.com/Azure/azure-sdk-for-go/profiles/latest/redis/mgmt/cache
github.com/Azure/azure-sdk-for-go/profiles/latest/redis/mgmt/redis
github.com/Azure/azure-sdk-for-go/profiles/latest/relay/mgmt/relay
github.com/Azure/azure-sdk-for-go/profiles/latest/resourcehealth/mgmt/resourcehealth
github.com/Azure/azure-sdk-for-go/profiles/latest/resources/mgmt/features
github.com/Azure/azure-sdk-for-go/profiles/latest/resources/mgmt/links
github.com/Azure/azure-sdk-for-go/profiles/latest/resources/mgmt/locks
github.com/Azure/azure-sdk-for-go/profiles/latest/resources/mgmt/policy
github.com/Azure/azure-sdk-for-go/profiles/latest/resources/mgmt/resources
github.com/Azure/azure-sdk-for-go/profiles/latest/resources/mgmt/subscriptions
github.com/Azure/azure-sdk-for-go/profiles/latest/scheduler/mgmt/scheduler
github.com/Azure/azure-sdk-for-go/profiles/latest/search/mgmt/search
github.com/Azure/azure-sdk-for-go/profiles/latest/search/search
github.com/Azure/azure-sdk-for-go/profiles/latest/servicebus/mgmt/servicebus
github.com/Azure/azure-sdk-for-go/profiles/latest/servicefabric/mgmt/servicefabric
github.com/Azure/azure-sdk-for-go/profiles/latest/servicefabric/servicefabric
github.com/Azure/azure-sdk-for-go/profiles/latest/sql/mgmt/sql
github.com/Azure/azure-sdk-for-go/profiles/latest/storage/mgmt/storage
github.com/Azure/azure-sdk-for-go/profiles/latest/storageimportexport/mgmt/storageimportexport
github.com/Azure/azure-sdk-for-go/profiles/latest/storsimple8000series/mgmt/storsimple
github.com/Azure/azure-sdk-for-go/profiles/latest/streamanalytics/mgmt/streamanalytics
github.com/Azure/azure-sdk-for-go/profiles/latest/trafficmanager/mgmt/trafficmanager
github.com/Azure/azure-sdk-for-go/profiles/latest/web/mgmt/web
github.com/Azure/azure-sdk-for-go/profiles/preview/advisor/mgmt/advisor
github.com/Azure/azure-sdk-for-go/profiles/preview/analysisservices/mgmt/analysisservices
github.com/Azure/azure-sdk-for-go/profiles/preview/appinsights/mgmt/insights
github.com/Azure/azure-sdk-for-go/profiles/preview/authorization/mgmt/authorization
github.com/Azure/azure-sdk-for-go/profiles/preview/automation/mgmt/automation
github.com/Azure/azure-sdk-for-go/profiles/preview/batch/batch
github.com/Azure/azure-sdk-for-go/profiles/preview/batch/mgmt/batch
github.com/Azure/azure-sdk-for-go/profiles/preview/billing/mgmt/billing
github.com/Azure/azure-sdk-for-go/profiles/preview/cdn/mgmt/cdn
github.com/Azure/azure-sdk-for-go/profiles/preview/cognitiveservices/computervision
github.com/Azure/azure-sdk-for-go/profiles/preview/cognitiveservices/contentmoderator
github.com/Azure/azure-sdk-for-go/profiles/preview/cognitiveservices/customsearch
github.com/Azure/azure-sdk-for-go/profiles/preview/cognitiveservices/entitysearch
github.com/Azure/azure-sdk-for-go/profiles/preview/cognitiveservices/face
github.com/Azure/azure-sdk-for-go/profiles/preview/cognitiveservices/imagesearch
github.com/Azure/azure-sdk-for-go/profiles/preview/cognitiveservices/luis/runtime
github.com/Azure/azure-sdk-for-go/profiles/preview/cognitiveservices/mgmt/cognitiveservices
github.com/Azure/azure-sdk-for-go/profiles/preview/cognitiveservices/newssearch
github.com/Azure/azure-sdk-for-go/profiles/preview/cognitiveservices/spellcheck
github.com/Azure/azure-sdk-for-go/profiles/preview/cognitiveservices/textanalytics
github.com/Azure/azure-sdk-for-go/profiles/preview/cognitiveservices/videosearch
github.com/Azure/azure-sdk-for-go/profiles/preview/cognitiveservices/websearch
github.com/Azure/azure-sdk-for-go/profiles/preview/commerce/mgmt/commerce
github.com/Azure/azure-sdk-for-go/profiles/preview/compute/mgmt/compute
github.com/Azure/azure-sdk-for-go/profiles/preview/containerinstance/mgmt/containerinstance
github.com/Azure/azure-sdk-for-go/profiles/preview/containerregistry/mgmt/containerregistry
github.com/Azure/azure-sdk-for-go/profiles/preview/containerservice/mgmt/containerservice
github.com/Azure/azure-sdk-for-go/profiles/preview/cosmos-db/mgmt/documentdb
github.com/Azure/azure-sdk-for-go/profiles/preview/customerinsights/mgmt/customerinsights
github.com/Azure/azure-sdk-for-go/profiles/preview/datafactory/mgmt/datafactory
github.com/Azure/azure-sdk-for-go/profiles/preview/datalake/analytics/catalog
github.com/Azure/azure-sdk-for-go/profiles/preview/datalake/analytics/job
github.com/Azure/azure-sdk-for-go/profiles/preview/datalake/analytics/mgmt/account
github.com/Azure/azure-sdk-for-go/profiles/preview/datalake/store/filesystem
github.com/Azure/azure-sdk-for-go/profiles/preview/datalake/store/mgmt/account
github.com/Azure/azure-sdk-for-go/profiles/preview/devtestlabs/mgmt/dtl
github.com/Azure/azure-sdk-for-go/profiles/preview/dns/mgmt/dns
github.com/Azure/azure-sdk-for-go/profiles/preview/domainservices/mgmt/aad
github.com/Azure/azure-sdk-for-go/profiles/preview/eventgrid/eventgrid
github.com/Azure/azure-sdk-for-go/profiles/preview/eventgrid/mgmt/eventgrid
github.com/Azure/azure-sdk-for-go/profiles/preview/eventhub/mgmt/eventhub
github.com/Azure/azure-sdk-for-go/profiles/preview/graphrbac/graphrbac
github.com/Azure/azure-sdk-for-go/profiles/preview/hdinsight/mgmt/hdinsight
github.com/Azure/azure-sdk-for-go/profiles/preview/iothub/mgmt/devices
github.com/Azure/azure-sdk-for-go/profiles/preview/keyvault/keyvault
github.com/Azure/azure-sdk-for-go/profiles/preview/keyvault/mgmt/keyvault
github.com/Azure/azure-sdk-for-go/profiles/preview/logic/mgmt/logic
github.com/Azure/azure-sdk-for-go/profiles/preview/machinelearning/mgmt/commitmentplans
github.com/Azure/azure-sdk-for-go/profiles/preview/machinelearning/mgmt/compute
github.com/Azure/azure-sdk-for-go/profiles/preview/machinelearning/mgmt/experimentation
github.com/Azure/azure-sdk-for-go/profiles/preview/machinelearning/mgmt/webservices
github.com/Azure/azure-sdk-for-go/profiles/preview/marketplaceordering/mgmt/marketplaceordering
github.com/Azure/azure-sdk-for-go/profiles/preview/mediaservices/mgmt/media
github.com/Azure/azure-sdk-for-go/profiles/preview/mobileengagement/mgmt/mobileengagement
github.com/Azure/azure-sdk-for-go/profiles/preview/monitor/mgmt/insights
github.com/Azure/azure-sdk-for-go/profiles/preview/msi/mgmt/msi
github.com/Azure/azure-sdk-for-go/profiles/preview/mysql/mgmt/mysql
github.com/Azure/azure-sdk-for-go/profiles/preview/network/mgmt/network
github.com/Azure/azure-sdk-for-go/profiles/preview/notificationhubs/mgmt/notificationhubs
github.com/Azure/azure-sdk-for-go/profiles/preview/operationalinsights/mgmt/operationalinsights
github.com/Azure/azure-sdk-for-go/profiles/preview/operationalinsights/mgmt/servicemap
github.com/Azure/azure-sdk-for-go/profiles/preview/operationsmanagement/mgmt/operationsmanagement
github.com/Azure/azure-sdk-for-go/profiles/preview/postgresql/mgmt/postgresql
github.com/Azure/azure-sdk-for-go/profiles/preview/powerbiembedded/mgmt/powerbiembedded
github.com/Azure/azure-sdk-for-go/profiles/preview/redis/mgmt/cache
github.com/Azure/azure-sdk-for-go/profiles/preview/redis/mgmt/redis
github.com/Azure/azure-sdk-for-go/profiles/preview/relay/mgmt/relay
github.com/Azure/azure-sdk-for-go/profiles/preview/resourcehealth/mgmt/resourcehealth
github.com/Azure/azure-sdk-for-go/profiles/preview/resources/mgmt/features
github.com/Azure/azure-sdk-for-go/profiles/preview/resources/mgmt/links
github.com/Azure/azure-sdk-for-go/profiles/preview/resources/mgmt/locks
github.com/Azure/azure-sdk-for-go/profiles/preview/resources/mgmt/managedapplications
github.com/Azure/azure-sdk-for-go/profiles/preview/resources/mgmt/management
github.com/Azure/azure-sdk-for-go/profiles/preview/resources/mgmt/policy
github.com/Azure/azure-sdk-for-go/profiles/preview/resources/mgmt/resources
github.com/Azure/azure-sdk-for-go/profiles/preview/resources/mgmt/subscriptions
github.com/Azure/azure-sdk-for-go/profiles/preview/scheduler/mgmt/scheduler
github.com/Azure/azure-sdk-for-go/profiles/preview/search/mgmt/search
github.com/Azure/azure-sdk-for-go/profiles/preview/search/search
github.com/Azure/azure-sdk-for-go/profiles/preview/servermanagement/mgmt/servermanagement
github.com/Azure/azure-sdk-for-go/profiles/preview/servicebus/mgmt/servicebus
github.com/Azure/azure-sdk-for-go/profiles/preview/servicefabric/mgmt/servicefabric
github.com/Azure/azure-sdk-for-go/profiles/preview/servicefabric/servicefabric
github.com/Azure/azure-sdk-for-go/profiles/preview/sql/mgmt/sql
github.com/Azure/azure-sdk-for-go/profiles/preview/storage/mgmt/storage
github.com/Azure/azure-sdk-for-go/profiles/preview/storageimportexport/mgmt/storageimportexport
github.com/Azure/azure-sdk-for-go/profiles/preview/storsimple8000series/mgmt/storsimple
github.com/Azure/azure-sdk-for-go/profiles/preview/streamanalytics/mgmt/streamanalytics
github.com/Azure/azure-sdk-for-go/profiles/preview/trafficmanager/mgmt/trafficmanager
github.com/Azure/azure-sdk-for-go/profiles/preview/visualstudio/mgmt/visualstudio
github.com/Azure/azure-sdk-for-go/profiles/preview/web/mgmt/web
github.com/Azure/azure-sdk-for-go/services/advisor/mgmt/2016-07-12-preview/advisor
github.com/Azure/azure-sdk-for-go/services/advisor/mgmt/2017-03-31/advisor
github.com/Azure/azure-sdk-for-go/services/advisor/mgmt/2017-04-19/advisor
github.com/Azure/azure-sdk-for-go/services/analysisservices/mgmt/2016-05-16/analysisservices
github.com/Azure/azure-sdk-for-go/services/analysisservices/mgmt/2017-07-14/analysisservices
github.com/Azure/azure-sdk-for-go/services/analysisservices/mgmt/2017-08-01-beta/analysisservices
github.com/Azure/azure-sdk-for-go/services/apimanagement/mgmt/2016-10-10/apimanagement
github.com/Azure/azure-sdk-for-go/services/appinsights/mgmt/2015-05-01/insights
github.com/Azure/azure-sdk-for-go/services/authorization/mgmt/2015-07-01/authorization
github.com/Azure/azure-sdk-for-go/services/authorization/mgmt/2017-10-01-preview/authorization
github.com/Azure/azure-sdk-for-go/services/automation/mgmt/2015-10-31/automation
github.com/Azure/azure-sdk-for-go/services/batch/2017-05-01.5.0/batch
github.com/Azure/azure-sdk-for-go/services/batch/mgmt/2015-12-01/batch
github.com/Azure/azure-sdk-for-go/services/batch/mgmt/2017-01-01/batch
github.com/Azure/azure-sdk-for-go/services/batch/mgmt/2017-05-01/batch
github.com/Azure/azure-sdk-for-go/services/batch/mgmt/2017-09-01/batch
github.com/Azure/azure-sdk-for-go/services/billing/mgmt/2017-02-27-preview/billing
github.com/Azure/azure-sdk-for-go/services/billing/mgmt/2017-04-24-preview/billing
github.com/Azure/azure-sdk-for-go/services/cdn/mgmt/2015-06-01/cdn
github.com/Azure/azure-sdk-for-go/services/cdn/mgmt/2016-04-02/cdn
github.com/Azure/azure-sdk-for-go/services/cdn/mgmt/2016-10-02/cdn
github.com/Azure/azure-sdk-for-go/services/cdn/mgmt/2017-04-02/cdn
github.com/Azure/azure-sdk-for-go/services/cognitiveservices/luis/v2.0/runtime
github.com/Azure/azure-sdk-for-go/services/cognitiveservices/mgmt/2016-02-01-preview/cognitiveservices
github.com/Azure/azure-sdk-for-go/services/cognitiveservices/mgmt/2017-04-18/cognitiveservices
github.com/Azure/azure-sdk-for-go/services/cognitiveservices/v1.0/computervision
github.com/Azure/azure-sdk-for-go/services/cognitiveservices/v1.0/contentmoderator
github.com/Azure/azure-sdk-for-go/services/cognitiveservices/v1.0/customsearch
github.com/Azure/azure-sdk-for-go/services/cognitiveservices/v1.0/entitysearch
github.com/Azure/azure-sdk-for-go/services/cognitiveservices/v1.0/face
github.com/Azure/azure-sdk-for-go/services/cognitiveservices/v1.0/imagesearch
github.com/Azure/azure-sdk-for-go/services/cognitiveservices/v1.0/newssearch
github.com/Azure/azure-sdk-for-go/services/cognitiveservices/v1.0/spellcheck
github.com/Azure/azure-sdk-for-go/services/cognitiveservices/v1.0/videosearch
github.com/Azure/azure-sdk-for-go/services/cognitiveservices/v1.0/websearch
github.com/Azure/azure-sdk-for-go/services/cognitiveservices/v2.0/textanalytics
github.com/Azure/azure-sdk-for-go/services/commerce/mgmt/2015-06-01-preview/commerce
github.com/Azure/azure-sdk-for-go/services/compute/mgmt/2015-06-15/compute
github.com/Azure/azure-sdk-for-go/services/compute/mgmt/2016-03-30/compute
github.com/Azure/azure-sdk-for-go/services/compute/mgmt/2016-04-30-preview/compute
github.com/Azure/azure-sdk-for-go/services/compute/mgmt/2017-03-30/compute
github.com/Azure/azure-sdk-for-go/services/consumption/mgmt/2017-04-24-preview/consumption
github.com/Azure/azure-sdk-for-go/services/containerinstance/mgmt/2017-08-01-preview/containerinstance
github.com/Azure/azure-sdk-for-go/services/containerregistry/mgmt/2017-03-01/containerregistry
github.com/Azure/azure-sdk-for-go/services/containerregistry/mgmt/2017-06-01-preview/containerregistry
github.com/Azure/azure-sdk-for-go/services/containerregistry/mgmt/2017-10-01/containerregistry
github.com/Azure/azure-sdk-for-go/services/containerservice/mgmt/2015-11-01-preview/containerservice
github.com/Azure/azure-sdk-for-go/services/containerservice/mgmt/2016-03-30/containerservice
github.com/Azure/azure-sdk-for-go/services/containerservice/mgmt/2016-09-30/containerservice
github.com/Azure/azure-sdk-for-go/services/containerservice/mgmt/2017-01-31/containerservice
github.com/Azure/azure-sdk-for-go/services/containerservice/mgmt/2017-07-01/containerservice
github.com/Azure/azure-sdk-for-go/services/containerservice/mgmt/2017-08-31/containerservice
github.com/Azure/azure-sdk-for-go/services/containerservice/mgmt/2017-09-30/containerservice
github.com/Azure/azure-sdk-for-go/services/cosmos-db/mgmt/2015-04-08/documentdb
github.com/Azure/azure-sdk-for-go/services/cosmos-db/mongodb
github.com/Azure/azure-sdk-for-go/services/customerinsights/mgmt/2017-01-01/customerinsights
github.com/Azure/azure-sdk-for-go/services/customerinsights/mgmt/2017-04-26/customerinsights
github.com/Azure/azure-sdk-for-go/services/datafactory/mgmt/2017-09-01-preview/datafactory
github.com/Azure/azure-sdk-for-go/services/datalake/analytics/2015-10-01-preview/catalog
github.com/Azure/azure-sdk-for-go/services/datalake/analytics/2015-11-01-preview/job
github.com/Azure/azure-sdk-for-go/services/datalake/analytics/2016-03-20-preview/job
github.com/Azure/azure-sdk-for-go/services/datalake/analytics/2016-11-01/job
github.com/Azure/azure-sdk-for-go/services/datalake/analytics/2016-11-01-preview/catalog
github.com/Azure/azure-sdk-for-go/services/datalake/analytics/2017-09-01-preview/job
github.com/Azure/azure-sdk-for-go/services/datalake/analytics/mgmt/2015-10-01-preview/account
github.com/Azure/azure-sdk-for-go/services/datalake/analytics/mgmt/2016-11-01/account
github.com/Azure/azure-sdk-for-go/services/datalake/store/2015-10-01-preview/filesystem
github.com/Azure/azure-sdk-for-go/services/datalake/store/2016-11-01/filesystem
github.com/Azure/azure-sdk-for-go/services/datalake/store/mgmt/2015-10-01-preview/account
github.com/Azure/azure-sdk-for-go/services/datalake/store/mgmt/2016-11-01/account
github.com/Azure/azure-sdk-for-go/services/devtestlabs/mgmt/2015-05-21-preview/dtl
github.com/Azure/azure-sdk-for-go/services/devtestlabs/mgmt/2016-05-15/dtl
github.com/Azure/azure-sdk-for-go/services/dns/mgmt/2015-05-04-preview/dns
github.com/Azure/azure-sdk-for-go/services/dns/mgmt/2016-04-01/dns
github.com/Azure/azure-sdk-for-go/services/dns/mgmt/2017-09-01/dns
github.com/Azure/azure-sdk-for-go/services/domainservices/mgmt/2017-01-01/aad
github.com/Azure/azure-sdk-for-go/services/eventgrid/2018-01-01/eventgrid
github.com/Azure/azure-sdk-for-go/services/eventgrid/mgmt/2017-06-15-preview/eventgrid
github.com/Azure/azure-sdk-for-go/services/eventgrid/mgmt/2017-09-15-preview/eventgrid
github.com/Azure/azure-sdk-for-go/services/eventhub/mgmt/2015-08-01/eventhub
github.com/Azure/azure-sdk-for-go/services/eventhub/mgmt/2017-04-01/eventhub
github.com/Azure/azure-sdk-for-go/services/graphrbac/1.6/graphrbac
github.com/Azure/azure-sdk-for-go/services/hdinsight/mgmt/2015-03-01-preview/hdinsight
github.com/Azure/azure-sdk-for-go/services/iothub/mgmt/2016-02-03/devices
github.com/Azure/azure-sdk-for-go/services/iothub/mgmt/2017-01-19/devices
github.com/Azure/azure-sdk-for-go/services/iothub/mgmt/2017-07-01/devices
github.com/Azure/azure-sdk-for-go/services/keyvault/2015-06-01/keyvault
github.com/Azure/azure-sdk-for-go/services/keyvault/2016-10-01/keyvault
github.com/Azure/azure-sdk-for-go/services/keyvault/mgmt/2015-06-01/keyvault
github.com/Azure/azure-sdk-for-go/services/keyvault/mgmt/2016-10-01/keyvault
github.com/Azure/azure-sdk-for-go/services/logic/mgmt/2015-02-01-preview/logic
github.com/Azure/azure-sdk-for-go/services/logic/mgmt/2015-08-01-preview/logic
github.com/Azure/azure-sdk-for-go/services/logic/mgmt/2016-06-01/logic
github.com/Azure/azure-sdk-for-go/services/machinelearning/mgmt/2016-05-01-preview/commitmentplans
github.com/Azure/azure-sdk-for-go/services/machinelearning/mgmt/2016-05-01-preview/webservices
github.com/Azure/azure-sdk-for-go/services/machinelearning/mgmt/2017-01-01/webservices
github.com/Azure/azure-sdk-for-go/services/machinelearning/mgmt/2017-05-01-preview/experimentation
github.com/Azure/azure-sdk-for-go/services/machinelearning/mgmt/2017-08-01-preview/compute
github.com/Azure/azure-sdk-for-go/services/marketplaceordering/mgmt/2015-06-01/marketplaceordering
github.com/Azure/azure-sdk-for-go/services/mediaservices/mgmt/2015-10-01/media
github.com/Azure/azure-sdk-for-go/services/mobileengagement/mgmt/2014-12-01/mobileengagement
github.com/Azure/azure-sdk-for-go/services/monitor/mgmt/2017-05-01-preview/insights
github.com/Azure/azure-sdk-for-go/services/msi/mgmt/2015-08-31-preview/msi
github.com/Azure/azure-sdk-for-go/services/mysql/mgmt/2017-04-30-preview/mysql
github.com/Azure/azure-sdk-for-go/services/network/mgmt/2015-05-01-preview/network
github.com/Azure/azure-sdk-for-go/services/network/mgmt/2015-06-15/network
github.com/Azure/azure-sdk-for-go/services/network/mgmt/2016-03-30/network
github.com/Azure/azure-sdk-for-go/services/network/mgmt/2016-06-01/network
github.com/Azure/azure-sdk-for-go/services/network/mgmt/2016-09-01/network
github.com/Azure/azure-sdk-for-go/services/network/mgmt/2016-12-01/network
github.com/Azure/azure-sdk-for-go/services/network/mgmt/2017-03-01/network
github.com/Azure/azure-sdk-for-go/services/network/mgmt/2017-06-01/network
github.com/Azure/azure-sdk-for-go/services/network/mgmt/2017-08-01/network
github.com/Azure/azure-sdk-for-go/services/network/mgmt/2017-09-01/network
github.com/Azure/azure-sdk-for-go/services/notificationhubs/mgmt/2014-09-01/notificationhubs
github.com/Azure/azure-sdk-for-go/services/notificationhubs/mgmt/2016-03-01/notificationhubs
github.com/Azure/azure-sdk-for-go/services/notificationhubs/mgmt/2017-04-01/notificationhubs
github.com/Azure/azure-sdk-for-go/services/operationalinsights/mgmt/2015-03-20/operationalinsights
github.com/Azure/azure-sdk-for-go/services/operationalinsights/mgmt/2015-11-01-preview/operationalinsights
github.com/Azure/azure-sdk-for-go/services/operationalinsights/mgmt/2015-11-01-preview/servicemap
github.com/Azure/azure-sdk-for-go/services/operationalinsights/v1/operationalinsights
github.com/Azure/azure-sdk-for-go/services/operationsmanagement/mgmt/2015-11-01-preview/operationsmanagement
github.com/Azure/azure-sdk-for-go/services/postgresql/mgmt/2017-04-30-preview/postgresql
github.com/Azure/azure-sdk-for-go/services/powerbiembedded/mgmt/2016-01-29/powerbiembedded
github.com/Azure/azure-sdk-for-go/services/redis/mgmt/2015-08-01/redis
github.com/Azure/azure-sdk-for-go/services/redis/mgmt/2016-04-01/redis
github.com/Azure/azure-sdk-for-go/services/redis/mgmt/2017-02-01/redis
github.com/Azure/azure-sdk-for-go/services/redis/mgmt/2017-10-01/cache
github.com/Azure/azure-sdk-for-go/services/relay/mgmt/2016-07-01/relay
github.com/Azure/azure-sdk-for-go/services/relay/mgmt/2017-04-01/relay
github.com/Azure/azure-sdk-for-go/services/resourcehealth/mgmt/2015-01-01/resourcehealth
github.com/Azure/azure-sdk-for-go/services/resourcehealth/mgmt/2017-07-01/resourcehealth
github.com/Azure/azure-sdk-for-go/services/resources
github.com/Azure/azure-sdk-for-go/services/resources/mgmt/2015-01-01/locks
github.com/Azure/azure-sdk-for-go/services/resources/mgmt/2015-10-01-preview/policy
github.com/Azure/azure-sdk-for-go/services/resources/mgmt/2015-11-01/resources
github.com/Azure/azure-sdk-for-go/services/resources/mgmt/2015-11-01/subscriptions
github.com/Azure/azure-sdk-for-go/services/resources/mgmt/2015-12-01/features
github.com/Azure/azure-sdk-for-go/services/resources/mgmt/2016-02-01/resources
github.com/Azure/azure-sdk-for-go/services/resources/mgmt/2016-04-01/policy
github.com/Azure/azure-sdk-for-go/services/resources/mgmt/2016-06-01/subscriptions
github.com/Azure/azure-sdk-for-go/services/resources/mgmt/2016-07-01/resources
github.com/Azure/azure-sdk-for-go/services/resources/mgmt/2016-09-01/links
github.com/Azure/azure-sdk-for-go/services/resources/mgmt/2016-09-01/locks
github.com/Azure/azure-sdk-for-go/services/resources/mgmt/2016-09-01/resources
github.com/Azure/azure-sdk-for-go/services/resources/mgmt/2016-09-01-preview/managedapplications
github.com/Azure/azure-sdk-for-go/services/resources/mgmt/2016-12-01/policy
github.com/Azure/azure-sdk-for-go/services/resources/mgmt/2017-05-10/resources
github.com/Azure/azure-sdk-for-go/services/resources/mgmt/2017-06-01-preview/policy
github.com/Azure/azure-sdk-for-go/services/resources/mgmt/2017-08-31-preview/management
github.com/Azure/azure-sdk-for-go/services/scheduler/mgmt/2014-08-01-preview/scheduler
github.com/Azure/azure-sdk-for-go/services/scheduler/mgmt/2016-01-01/scheduler
github.com/Azure/azure-sdk-for-go/services/scheduler/mgmt/2016-03-01/scheduler
github.com/Azure/azure-sdk-for-go/services/search/2016-09-01/search
github.com/Azure/azure-sdk-for-go/services/search/mgmt/2015-02-28/search
github.com/Azure/azure-sdk-for-go/services/search/mgmt/2015-08-19/search
github.com/Azure/azure-sdk-for-go/services/servermanagement/mgmt/2015-07-01-preview/servermanagement
github.com/Azure/azure-sdk-for-go/services/servermanagement/mgmt/2016-07-01-preview/servermanagement
github.com/Azure/azure-sdk-for-go/services/servicebus/mgmt/2015-08-01/servicebus
github.com/Azure/azure-sdk-for-go/services/servicebus/mgmt/2017-04-01/servicebus
github.com/Azure/azure-sdk-for-go/services/servicefabric/1.0.0/servicefabric
github.com/Azure/azure-sdk-for-go/services/servicefabric/5.6/servicefabric
github.com/Azure/azure-sdk-for-go/services/servicefabric/6.0/servicefabric
github.com/Azure/azure-sdk-for-go/services/servicefabric/mgmt/2016-09-01/servicefabric
github.com/Azure/azure-sdk-for-go/services/servicefabric/mgmt/2017-07-01-preview/servicefabric
github.com/Azure/azure-sdk-for-go/services/sql/mgmt/2014-04-01/sql
github.com/Azure/azure-sdk-for-go/services/sql/mgmt/2015-05-01-preview/sql
github.com/Azure/azure-sdk-for-go/services/sql/mgmt/2017-03-01-preview/sql
github.com/Azure/azure-sdk-for-go/services/storage/mgmt/2015-05-01-preview/storage
github.com/Azure/azure-sdk-for-go/services/storage/mgmt/2015-06-15/storage
github.com/Azure/azure-sdk-for-go/services/storage/mgmt/2016-01-01/storage
github.com/Azure/azure-sdk-for-go/services/storage/mgmt/2016-05-01/storage
github.com/Azure/azure-sdk-for-go/services/storage/mgmt/2016-12-01/storage
github.com/Azure/azure-sdk-for-go/services/storage/mgmt/2017-06-01/storage
github.com/Azure/azure-sdk-for-go/services/storage/mgmt/2017-10-01/storage
github.com/Azure/azure-sdk-for-go/services/storageimportexport/mgmt/2016-11-01/storageimportexport
github.com/Azure/azure-sdk-for-go/services/storsimple8000series/mgmt/2017-06-01/storsimple
github.com/Azure/azure-sdk-for-go/services/streamanalytics/mgmt/2016-03-01/streamanalytics
github.com/Azure/azure-sdk-for-go/services/trafficmanager/mgmt/2015-11-01/trafficmanager
github.com/Azure/azure-sdk-for-go/services/trafficmanager/mgmt/2017-03-01/trafficmanager
github.com/Azure/azure-sdk-for-go/services/trafficmanager/mgmt/2017-05-01/trafficmanager
github.com/Azure/azure-sdk-for-go/services/trafficmanager/mgmt/2017-09-01-preview/trafficmanager
github.com/Azure/azure-sdk-for-go/services/visualstudio/mgmt/2014-04-01-preview/visualstudio
github.com/Azure/azure-sdk-for-go/services/web/mgmt/2015-08-preview/web
github.com/Azure/azure-sdk-for-go/services/web/mgmt/2016-09-01/web
github.com/Azure/azure-sdk-for-go/storage
github.com/Azure/azure-sdk-for-go/tools/generator
github.com/Azure/azure-sdk-for-go/tools/profileBuilder
github.com/Azure/azure-storage-go
github.com/Azure/go-autorest/autorest
github.com/Azure/go-autorest/autorest/adal
github.com/Azure/go-autorest/autorest/adal/cmd
github.com/Azure/go-autorest/autorest/azure
github.com/Azure/go-autorest/autorest/azure/auth
github.com/Azure/go-autorest/autorest/azure/cli
github.com/Azure/go-autorest/autorest/azure/example
github.com/Azure/go-autorest/autorest/date
github.com/Azure/go-autorest/autorest/mocks
github.com/Azure/go-autorest/autorest/to
github.com/Azure/go-autorest/autorest/utils
github.com/Azure/go-autorest/autorest/validation
github.com/Boostport/avatica
github.com/Boostport/avatica/message
github.com/BurntSushi/toml
github.com/BurntSushi/toml/cmd/toml-test-decoder
github.com/BurntSushi/toml/cmd/toml-test-encoder
github.com/BurntSushi/toml/cmd/tomlv
github.com/DeDiS/protobuf
github.com/FiloSottile/Heartbleed
github.com/FiloSottile/Heartbleed/heartbleed
github.com/FiloSottile/Heartbleed/heartbleed/tls
github.com/FiloSottile/Heartbleed/logger
github.com/FiloSottile/Heartbleed/server
github.com/FiloSottile/Heartbleed/server/cache
github.com/FiloSottile/gorebuild
github.com/GeertJohan/go.rice
github.com/GeertJohan/go.rice/embedded
github.com/GeertJohan/go.rice/example
github.com/GeertJohan/go.rice/rice
github.com/GetStream/vg
github.com/GetStream/vg/cmd
github.com/GetStream/vg/internal/testsuite
github.com/GetStream/vg/internal/testwrapper/vg
github.com/GetStream/vg/internal/utils
github.com/GetStream/vg/internal/workspace
github.com/Gnouc/gogi
github.com/Gnouc/gogi/cmd/gogi
github.com/Luxurioust/excelize
github.com/Masterminds/glide
github.com/Masterminds/glide/action
github.com/Masterminds/glide/cache
github.com/Masterminds/glide/cfg
github.com/Masterminds/glide/dependency
github.com/Masterminds/glide/gb
github.com/Masterminds/glide/godep
github.com/Masterminds/glide/godep/strip
github.com/Masterminds/glide/gom
github.com/Masterminds/glide/gpm
github.com/Masterminds/glide/importer
github.com/Masterminds/glide/mirrors
github.com/Masterminds/glide/msg
github.com/Masterminds/glide/path
github.com/Masterminds/glide/repo
github.com/Masterminds/glide/tree
github.com/Masterminds/glide/util
github.com/MichaelTJones/walk
github.com/NYTimes/gziphandler
github.com/PuerkitoBio/goquery
github.com/PuerkitoBio/purell
github.com/PuerkitoBio/urlesc
github.com/SAP/go-hdb/driver
github.com/SAP/go-hdb/driver/sqltrace
github.com/SAP/go-hdb/internal/bufio
github.com/SAP/go-hdb/internal/protocol
github.com/SAP/go-hdb/internal/unicode
github.com/SAP/go-hdb/internal/unicode/cesu8
github.com/Sereal/Sereal/Go/sereal
github.com/Sereal/Sereal/Go/sereal/cmd/dsrl
github.com/Sereal/Sereal/Go/sereal/cmd/fuzzer
github.com/Sirupsen/logrus
github.com/Sirupsen/logrus/hooks/syslog
github.com/Sirupsen/logrus/hooks/test
github.com/TimothyYe/skm
github.com/TimothyYe/skm/cmd/skm
github.com/Unknwon/cae
github.com/Unknwon/cae/cae
github.com/Unknwon/cae/tz
github.com/Unknwon/cae/zip
github.com/VojtechVitek/go-trello
github.com/VojtechVitek/go-trello/tests
github.com/VoltDB/voltdb-client-go/examples/hello-world/async
github.com/VoltDB/voltdb-client-go/examples/hello-world/driver
github.com/VoltDB/voltdb-client-go/examples/hello-world/sync
github.com/VoltDB/voltdb-client-go/examples/voltkv
github.com/VoltDB/voltdb-client-go/examples/voter
github.com/VoltDB/voltdb-client-go/voltdbclient
github.com/VoltDB/voltdb-client-go/wire
github.com/aarzilli/gdlv
github.com/aarzilli/gdlv/examples
github.com/aarzilli/gdlv/examples/gdlv-example
github.com/aarzilli/gdlv/internal/assets
github.com/acroca/go-symbols
github.com/adnanh/webhook
github.com/adnanh/webhook/hook
github.com/adnanh/webhook/test
github.com/ahmetb/go-linq
github.com/ajg/form
github.com/alecthomas/binary
github.com/alecthomas/chroma
github.com/alecthomas/chroma/cmd/chroma
github.com/alecthomas/chroma/formatters
github.com/alecthomas/chroma/formatters/html
github.com/alecthomas/chroma/lexers
github.com/alecthomas/chroma/quick
github.com/alecthomas/chroma/styles
github.com/alecthomas/go_serialization_benchmarks
github.com/alecthomas/gometalinter
github.com/alecthomas/gometalinter/regressiontests
github.com/alecthomas/template
github.com/alecthomas/template/parse
github.com/alecthomas/units
github.com/alessio/shellescape
github.com/alessio/shellescape/escargs
github.com/alexbrainman/odbc
github.com/alexbrainman/odbc/api
github.com/alexflint/go-arg
github.com/andybalholm/cascadia
github.com/andybalholm/cascadia/fuzz
github.com/apex/log
github.com/apex/log/handlers/cli
github.com/apex/log/handlers/delta
github.com/apex/log/handlers/discard
github.com/apex/log/handlers/es
github.com/apex/log/handlers/graylog
github.com/apex/log/handlers/json
github.com/apex/log/handlers/kinesis
github.com/apex/log/handlers/level
github.com/apex/log/handlers/logfmt
github.com/apex/log/handlers/memory
github.com/apex/log/handlers/multi
github.com/apex/log/handlers/papertrail
github.com/apex/log/handlers/text
github.com/armon/consul-api
github.com/aryann/difflib
github.com/aryann/difflib/difflib_server
github.com/asaskevich/govalidator
github.com/asciimoo/coa
github.com/asciimoo/coa/action
github.com/asciimoo/coa/checker
github.com/asciimoo/coa/config
github.com/asciimoo/coa/event
github.com/asciimoo/coa/notification
github.com/asciimoo/coa/project
github.com/asciimoo/coa/server
github.com/asciimoo/wuzz
github.com/asciimoo/wuzz/config
github.com/asciimoo/wuzz/formatter
github.com/ashwch/precommit-vet-lint
github.com/aws/aws-sdk-go
github.com/aws/aws-sdk-go/aws
github.com/aws/aws-sdk-go/aws/arn
github.com/aws/aws-sdk-go/aws/awserr
github.com/aws/aws-sdk-go/aws/awsutil
github.com/aws/aws-sdk-go/aws/client
github.com/aws/aws-sdk-go/aws/client/metadata
github.com/aws/aws-sdk-go/aws/corehandlers
github.com/aws/aws-sdk-go/aws/credentials
github.com/aws/aws-sdk-go/aws/credentials/ec2rolecreds
github.com/aws/aws-sdk-go/aws/credentials/endpointcreds
github.com/aws/aws-sdk-go/aws/credentials/plugincreds
github.com/aws/aws-sdk-go/aws/credentials/stscreds
github.com/aws/aws-sdk-go/aws/defaults
github.com/aws/aws-sdk-go/aws/ec2metadata
github.com/aws/aws-sdk-go/aws/endpoints
github.com/aws/aws-sdk-go/aws/request
github.com/aws/aws-sdk-go/aws/session
github.com/aws/aws-sdk-go/aws/signer/v4
github.com/aws/aws-sdk-go/awstesting
github.com/aws/aws-sdk-go/awstesting/integration/customizations/s3
github.com/aws/aws-sdk-go/awstesting/integration/customizations/s3/s3manager
github.com/aws/aws-sdk-go/awstesting/mock
github.com/aws/aws-sdk-go/awstesting/unit
github.com/aws/aws-sdk-go/internal/shareddefaults
github.com/aws/aws-sdk-go/models/endpoints
github.com/aws/aws-sdk-go/private/model/api
github.com/aws/aws-sdk-go/private/protocol
github.com/aws/aws-sdk-go/private/protocol/ec2query
github.com/aws/aws-sdk-go/private/protocol/json/jsonutil
github.com/aws/aws-sdk-go/private/protocol/jsonrpc
github.com/aws/aws-sdk-go/private/protocol/query
github.com/aws/aws-sdk-go/private/protocol/query/queryutil
github.com/aws/aws-sdk-go/private/protocol/rest
github.com/aws/aws-sdk-go/private/protocol/restjson
github.com/aws/aws-sdk-go/private/protocol/restxml
github.com/aws/aws-sdk-go/private/protocol/xml/xmlutil
github.com/aws/aws-sdk-go/private/signer/v2
github.com/aws/aws-sdk-go/private/util
github.com/aws/aws-sdk-go/service
github.com/aws/aws-sdk-go/service/acm
github.com/aws/aws-sdk-go/service/acm/acmiface
github.com/aws/aws-sdk-go/service/alexaforbusiness
github.com/aws/aws-sdk-go/service/alexaforbusiness/alexaforbusinessiface
github.com/aws/aws-sdk-go/service/apigateway
github.com/aws/aws-sdk-go/service/apigateway/apigatewayiface
github.com/aws/aws-sdk-go/service/applicationautoscaling
github.com/aws/aws-sdk-go/service/applicationautoscaling/applicationautoscalingiface
github.com/aws/aws-sdk-go/service/applicationdiscoveryservice
github.com/aws/aws-sdk-go/service/applicationdiscoveryservice/applicationdiscoveryserviceiface
github.com/aws/aws-sdk-go/service/appstream
github.com/aws/aws-sdk-go/service/appstream/appstreamiface
github.com/aws/aws-sdk-go/service/appsync
github.com/aws/aws-sdk-go/service/appsync/appsynciface
github.com/aws/aws-sdk-go/service/athena
github.com/aws/aws-sdk-go/service/athena/athenaiface
github.com/aws/aws-sdk-go/service/autoscaling
github.com/aws/aws-sdk-go/service/autoscaling/autoscalingiface
github.com/aws/aws-sdk-go/service/autoscalingplans
github.com/aws/aws-sdk-go/service/autoscalingplans/autoscalingplansiface
github.com/aws/aws-sdk-go/service/batch
github.com/aws/aws-sdk-go/service/batch/batchiface
github.com/aws/aws-sdk-go/service/budgets
github.com/aws/aws-sdk-go/service/budgets/budgetsiface
github.com/aws/aws-sdk-go/service/cloud9
github.com/aws/aws-sdk-go/service/cloud9/cloud9iface
github.com/aws/aws-sdk-go/service/clouddirectory
github.com/aws/aws-sdk-go/service/clouddirectory/clouddirectoryiface
github.com/aws/aws-sdk-go/service/cloudformation
github.com/aws/aws-sdk-go/service/cloudformation/cloudformationiface
github.com/aws/aws-sdk-go/service/cloudfront
github.com/aws/aws-sdk-go/service/cloudfront/cloudfrontiface
github.com/aws/aws-sdk-go/service/cloudfront/sign
github.com/aws/aws-sdk-go/service/cloudhsm
github.com/aws/aws-sdk-go/service/cloudhsm/cloudhsmiface
github.com/aws/aws-sdk-go/service/cloudhsmv2
github.com/aws/aws-sdk-go/service/cloudhsmv2/cloudhsmv2iface
github.com/aws/aws-sdk-go/service/cloudsearch
github.com/aws/aws-sdk-go/service/cloudsearch/cloudsearchiface
github.com/aws/aws-sdk-go/service/cloudsearchdomain
github.com/aws/aws-sdk-go/service/cloudsearchdomain/cloudsearchdomainiface
github.com/aws/aws-sdk-go/service/cloudtrail
github.com/aws/aws-sdk-go/service/cloudtrail/cloudtrailiface
github.com/aws/aws-sdk-go/service/cloudwatch
github.com/aws/aws-sdk-go/service/cloudwatch/cloudwatchiface
github.com/aws/aws-sdk-go/service/cloudwatchevents
github.com/aws/aws-sdk-go/service/cloudwatchevents/cloudwatcheventsiface
github.com/aws/aws-sdk-go/service/cloudwatchlogs
github.com/aws/aws-sdk-go/service/cloudwatchlogs/cloudwatchlogsiface
github.com/aws/aws-sdk-go/service/codebuild
github.com/aws/aws-sdk-go/service/codebuild/codebuildiface
github.com/aws/aws-sdk-go/service/codecommit
github.com/aws/aws-sdk-go/service/codecommit/codecommitiface
github.com/aws/aws-sdk-go/service/codedeploy
github.com/aws/aws-sdk-go/service/codedeploy/codedeployiface
github.com/aws/aws-sdk-go/service/codepipeline
github.com/aws/aws-sdk-go/service/codepipeline/codepipelineiface
github.com/aws/aws-sdk-go/service/codestar
github.com/aws/aws-sdk-go/service/codestar/codestariface
github.com/aws/aws-sdk-go/service/cognitoidentity
github.com/aws/aws-sdk-go/service/cognitoidentity/cognitoidentityiface
github.com/aws/aws-sdk-go/service/cognitoidentityprovider
github.com/aws/aws-sdk-go/service/cognitoidentityprovider/cognitoidentityprovideriface
github.com/aws/aws-sdk-go/service/cognitosync
github.com/aws/aws-sdk-go/service/cognitosync/cognitosynciface
github.com/aws/aws-sdk-go/service/comprehend
github.com/aws/aws-sdk-go/service/comprehend/comprehendiface
github.com/aws/aws-sdk-go/service/configservice
github.com/aws/aws-sdk-go/service/configservice/configserviceiface
github.com/aws/aws-sdk-go/service/costandusagereportservice
github.com/aws/aws-sdk-go/service/costandusagereportservice/costandusagereportserviceiface
github.com/aws/aws-sdk-go/service/costexplorer
github.com/aws/aws-sdk-go/service/costexplorer/costexploreriface
github.com/aws/aws-sdk-go/service/databasemigrationservice
github.com/aws/aws-sdk-go/service/databasemigrationservice/databasemigrationserviceiface
github.com/aws/aws-sdk-go/service/datapipeline
github.com/aws/aws-sdk-go/service/datapipeline/datapipelineiface
github.com/aws/aws-sdk-go/service/dax
github.com/aws/aws-sdk-go/service/dax/daxiface
github.com/aws/aws-sdk-go/service/devicefarm
github.com/aws/aws-sdk-go/service/devicefarm/devicefarmiface
github.com/aws/aws-sdk-go/service/directconnect
github.com/aws/aws-sdk-go/service/directconnect/directconnectiface
github.com/aws/aws-sdk-go/service/directoryservice
github.com/aws/aws-sdk-go/service/directoryservice/directoryserviceiface
github.com/aws/aws-sdk-go/service/dynamodb
github.com/aws/aws-sdk-go/service/dynamodb/dynamodbattribute
github.com/aws/aws-sdk-go/service/dynamodb/dynamodbiface
github.com/aws/aws-sdk-go/service/dynamodb/expression
github.com/aws/aws-sdk-go/service/dynamodbstreams
github.com/aws/aws-sdk-go/service/dynamodbstreams/dynamodbstreamsiface
github.com/aws/aws-sdk-go/service/ec2
github.com/aws/aws-sdk-go/service/ec2/ec2iface
github.com/aws/aws-sdk-go/service/ecr
github.com/aws/aws-sdk-go/service/ecr/ecriface
github.com/aws/aws-sdk-go/service/ecs
github.com/aws/aws-sdk-go/service/ecs/ecsiface
github.com/aws/aws-sdk-go/service/efs
github.com/aws/aws-sdk-go/service/efs/efsiface
github.com/aws/aws-sdk-go/service/elasticache
github.com/aws/aws-sdk-go/service/elasticache/elasticacheiface
github.com/aws/aws-sdk-go/service/elasticbeanstalk
github.com/aws/aws-sdk-go/service/elasticbeanstalk/elasticbeanstalkiface
github.com/aws/aws-sdk-go/service/elasticsearchservice
github.com/aws/aws-sdk-go/service/elasticsearchservice/elasticsearchserviceiface
github.com/aws/aws-sdk-go/service/elastictranscoder
github.com/aws/aws-sdk-go/service/elastictranscoder/elastictranscoderiface
github.com/aws/aws-sdk-go/service/elb
github.com/aws/aws-sdk-go/service/elb/elbiface
github.com/aws/aws-sdk-go/service/elbv2
github.com/aws/aws-sdk-go/service/elbv2/elbv2iface
github.com/aws/aws-sdk-go/service/emr
github.com/aws/aws-sdk-go/service/emr/emriface
github.com/aws/aws-sdk-go/service/firehose
github.com/aws/aws-sdk-go/service/firehose/firehoseiface
github.com/aws/aws-sdk-go/service/gamelift
github.com/aws/aws-sdk-go/service/gamelift/gameliftiface
github.com/aws/aws-sdk-go/service/glacier
github.com/aws/aws-sdk-go/service/glacier/glacieriface
github.com/aws/aws-sdk-go/service/glue
github.com/aws/aws-sdk-go/service/glue/glueiface
github.com/aws/aws-sdk-go/service/greengrass
github.com/aws/aws-sdk-go/service/greengrass/greengrassiface
github.com/aws/aws-sdk-go/service/guardduty
github.com/aws/aws-sdk-go/service/guardduty/guarddutyiface
github.com/aws/aws-sdk-go/service/health
github.com/aws/aws-sdk-go/service/health/healthiface
github.com/aws/aws-sdk-go/service/iam
github.com/aws/aws-sdk-go/service/iam/iamiface
github.com/aws/aws-sdk-go/service/inspector
github.com/aws/aws-sdk-go/service/inspector/inspectoriface
github.com/aws/aws-sdk-go/service/iot
github.com/aws/aws-sdk-go/service/iot/iotiface
github.com/aws/aws-sdk-go/service/iotdataplane
github.com/aws/aws-sdk-go/service/iotdataplane/iotdataplaneiface
github.com/aws/aws-sdk-go/service/iotjobsdataplane
github.com/aws/aws-sdk-go/service/iotjobsdataplane/iotjobsdataplaneiface
github.com/aws/aws-sdk-go/service/kinesis
github.com/aws/aws-sdk-go/service/kinesis/kinesisiface
github.com/aws/aws-sdk-go/service/kinesisanalytics
github.com/aws/aws-sdk-go/service/kinesisanalytics/kinesisanalyticsiface
github.com/aws/aws-sdk-go/service/kinesisvideo
github.com/aws/aws-sdk-go/service/kinesisvideo/kinesisvideoiface
github.com/aws/aws-sdk-go/service/kinesisvideoarchivedmedia
github.com/aws/aws-sdk-go/service/kinesisvideoarchivedmedia/kinesisvideoarchivedmediaiface
github.com/aws/aws-sdk-go/service/kinesisvideomedia
github.com/aws/aws-sdk-go/service/kinesisvideomedia/kinesisvideomediaiface
github.com/aws/aws-sdk-go/service/kms
github.com/aws/aws-sdk-go/service/kms/kmsiface
github.com/aws/aws-sdk-go/service/lambda
github.com/aws/aws-sdk-go/service/lambda/lambdaiface
github.com/aws/aws-sdk-go/service/lexmodelbuildingservice
github.com/aws/aws-sdk-go/service/lexmodelbuildingservice/lexmodelbuildingserviceiface
github.com/aws/aws-sdk-go/service/lexruntimeservice
github.com/aws/aws-sdk-go/service/lexruntimeservice/lexruntimeserviceiface
github.com/aws/aws-sdk-go/service/lightsail
github.com/aws/aws-sdk-go/service/lightsail/lightsailiface
github.com/aws/aws-sdk-go/service/machinelearning
github.com/aws/aws-sdk-go/service/machinelearning/machinelearningiface
github.com/aws/aws-sdk-go/service/marketplacecommerceanalytics
github.com/aws/aws-sdk-go/service/marketplacecommerceanalytics/marketplacecommerceanalyticsiface
github.com/aws/aws-sdk-go/service/marketplaceentitlementservice
github.com/aws/aws-sdk-go/service/marketplaceentitlementservice/marketplaceentitlementserviceiface
github.com/aws/aws-sdk-go/service/marketplacemetering
github.com/aws/aws-sdk-go/service/marketplacemetering/marketplacemeteringiface
github.com/aws/aws-sdk-go/service/mediaconvert
github.com/aws/aws-sdk-go/service/mediaconvert/mediaconvertiface
github.com/aws/aws-sdk-go/service/medialive
github.com/aws/aws-sdk-go/service/medialive/medialiveiface
github.com/aws/aws-sdk-go/service/mediapackage
github.com/aws/aws-sdk-go/service/mediapackage/mediapackageiface
github.com/aws/aws-sdk-go/service/mediastore
github.com/aws/aws-sdk-go/service/mediastore/mediastoreiface
github.com/aws/aws-sdk-go/service/mediastoredata
github.com/aws/aws-sdk-go/service/mediastoredata/mediastoredataiface
github.com/aws/aws-sdk-go/service/migrationhub
github.com/aws/aws-sdk-go/service/migrationhub/migrationhubiface
github.com/aws/aws-sdk-go/service/mobile
github.com/aws/aws-sdk-go/service/mobile/mobileiface
github.com/aws/aws-sdk-go/service/mobileanalytics
github.com/aws/aws-sdk-go/service/mobileanalytics/mobileanalyticsiface
github.com/aws/aws-sdk-go/service/mq
github.com/aws/aws-sdk-go/service/mq/mqiface
github.com/aws/aws-sdk-go/service/mturk
github.com/aws/aws-sdk-go/service/mturk/mturkiface
github.com/aws/aws-sdk-go/service/opsworks
github.com/aws/aws-sdk-go/service/opsworks/opsworksiface
github.com/aws/aws-sdk-go/service/opsworkscm
github.com/aws/aws-sdk-go/service/opsworkscm/opsworkscmiface
github.com/aws/aws-sdk-go/service/organizations
github.com/aws/aws-sdk-go/service/organizations/organizationsiface
github.com/aws/aws-sdk-go/service/pinpoint
github.com/aws/aws-sdk-go/service/pinpoint/pinpointiface
github.com/aws/aws-sdk-go/service/polly
github.com/aws/aws-sdk-go/service/polly/pollyiface
github.com/aws/aws-sdk-go/service/pricing
github.com/aws/aws-sdk-go/service/pricing/pricingiface
github.com/aws/aws-sdk-go/service/rds
github.com/aws/aws-sdk-go/service/rds/rdsiface
github.com/aws/aws-sdk-go/service/rds/rdsutils
github.com/aws/aws-sdk-go/service/redshift
github.com/aws/aws-sdk-go/service/redshift/redshiftiface
github.com/aws/aws-sdk-go/service/rekognition
github.com/aws/aws-sdk-go/service/rekognition/rekognitioniface
github.com/aws/aws-sdk-go/service/resourcegroups
github.com/aws/aws-sdk-go/service/resourcegroups/resourcegroupsiface
github.com/aws/aws-sdk-go/service/resourcegroupstaggingapi
github.com/aws/aws-sdk-go/service/resourcegroupstaggingapi/resourcegroupstaggingapiiface
github.com/aws/aws-sdk-go/service/route53
github.com/aws/aws-sdk-go/service/route53/route53iface
github.com/aws/aws-sdk-go/service/route53domains
github.com/aws/aws-sdk-go/service/route53domains/route53domainsiface
github.com/aws/aws-sdk-go/service/s3
github.com/aws/aws-sdk-go/service/s3/s3crypto
github.com/aws/aws-sdk-go/service/s3/s3iface
github.com/aws/aws-sdk-go/service/s3/s3manager
github.com/aws/aws-sdk-go/service/s3/s3manager/s3manageriface
github.com/aws/aws-sdk-go/service/sagemaker
github.com/aws/aws-sdk-go/service/sagemaker/sagemakeriface
github.com/aws/aws-sdk-go/service/sagemakerruntime
github.com/aws/aws-sdk-go/service/sagemakerruntime/sagemakerruntimeiface
github.com/aws/aws-sdk-go/service/serverlessapplicationrepository
github.com/aws/aws-sdk-go/service/serverlessapplicationrepository/serverlessapplicationrepositoryiface
github.com/aws/aws-sdk-go/service/servicecatalog
github.com/aws/aws-sdk-go/service/servicecatalog/servicecatalogiface
github.com/aws/aws-sdk-go/service/servicediscovery
github.com/aws/aws-sdk-go/service/servicediscovery/servicediscoveryiface
github.com/aws/aws-sdk-go/service/ses
github.com/aws/aws-sdk-go/service/ses/sesiface
github.com/aws/aws-sdk-go/service/sfn
github.com/aws/aws-sdk-go/service/sfn/sfniface
github.com/aws/aws-sdk-go/service/shield
github.com/aws/aws-sdk-go/service/shield/shieldiface
github.com/aws/aws-sdk-go/service/simpledb
github.com/aws/aws-sdk-go/service/simpledb/simpledbiface
github.com/aws/aws-sdk-go/service/sms
github.com/aws/aws-sdk-go/service/sms/smsiface
github.com/aws/aws-sdk-go/service/snowball
github.com/aws/aws-sdk-go/service/snowball/snowballiface
github.com/aws/aws-sdk-go/service/sns
github.com/aws/aws-sdk-go/service/sns/snsiface
github.com/aws/aws-sdk-go/service/sqs
github.com/aws/aws-sdk-go/service/sqs/sqsiface
github.com/aws/aws-sdk-go/service/ssm
github.com/aws/aws-sdk-go/service/ssm/ssmiface
github.com/aws/aws-sdk-go/service/storagegateway
github.com/aws/aws-sdk-go/service/storagegateway/storagegatewayiface
github.com/aws/aws-sdk-go/service/sts
github.com/aws/aws-sdk-go/service/sts/stsiface
github.com/aws/aws-sdk-go/service/support
github.com/aws/aws-sdk-go/service/support/supportiface
github.com/aws/aws-sdk-go/service/swf
github.com/aws/aws-sdk-go/service/swf/swfiface
github.com/aws/aws-sdk-go/service/transcribeservice
github.com/aws/aws-sdk-go/service/transcribeservice/transcribeserviceiface
github.com/aws/aws-sdk-go/service/translate
github.com/aws/aws-sdk-go/service/translate/translateiface
github.com/aws/aws-sdk-go/service/waf
github.com/aws/aws-sdk-go/service/waf/wafiface
github.com/aws/aws-sdk-go/service/wafregional
github.com/aws/aws-sdk-go/service/wafregional/wafregionaliface
github.com/aws/aws-sdk-go/service/workdocs
github.com/aws/aws-sdk-go/service/workdocs/workdocsiface
github.com/aws/aws-sdk-go/service/workmail
github.com/aws/aws-sdk-go/service/workmail/workmailiface
github.com/aws/aws-sdk-go/service/workspaces
github.com/aws/aws-sdk-go/service/workspaces/workspacesiface
github.com/aws/aws-sdk-go/service/xray
github.com/aws/aws-sdk-go/service/xray/xrayiface
github.com/awslabs/aws-sam-local
github.com/awslabs/aws-sam-local/router
github.com/aybabtme/godotto
github.com/aybabtme/godotto/cmd/dorepl
github.com/aybabtme/godotto/internal/godojs
github.com/aybabtme/godotto/internal/godoutil
github.com/aybabtme/godotto/internal/ottoutil
github.com/aybabtme/godotto/internal/ottoutil/jsvendor/corejs
github.com/aybabtme/godotto/internal/repl
github.com/aybabtme/godotto/internal/vmtest
github.com/aybabtme/godotto/pkg/accounts
github.com/aybabtme/godotto/pkg/actions
github.com/aybabtme/godotto/pkg/domains
github.com/aybabtme/godotto/pkg/droplets
github.com/aybabtme/godotto/pkg/extra/do/cloud
github.com/aybabtme/godotto/pkg/extra/do/cloud/accounts
github.com/aybabtme/godotto/pkg/extra/do/cloud/actions
github.com/aybabtme/godotto/pkg/extra/do/cloud/domains
github.com/aybabtme/godotto/pkg/extra/do/cloud/droplets
github.com/aybabtme/godotto/pkg/extra/do/cloud/firewalls
github.com/aybabtme/godotto/pkg/extra/do/cloud/floatingips
github.com/aybabtme/godotto/pkg/extra/do/cloud/images
github.com/aybabtme/godotto/pkg/extra/do/cloud/keys
github.com/aybabtme/godotto/pkg/extra/do/cloud/loadbalancers
github.com/aybabtme/godotto/pkg/extra/do/cloud/regions
github.com/aybabtme/godotto/pkg/extra/do/cloud/sizes
github.com/aybabtme/godotto/pkg/extra/do/cloud/snapshots
github.com/aybabtme/godotto/pkg/extra/do/cloud/tags
github.com/aybabtme/godotto/pkg/extra/do/cloud/volumes
github.com/aybabtme/godotto/pkg/extra/do/mockcloud
github.com/aybabtme/godotto/pkg/extra/do/spycloud
github.com/aybabtme/godotto/pkg/extra/ssh
github.com/aybabtme/godotto/pkg/firewalls
github.com/aybabtme/godotto/pkg/floatingips
github.com/aybabtme/godotto/pkg/images
github.com/aybabtme/godotto/pkg/keys
github.com/aybabtme/godotto/pkg/loadbalancers
github.com/aybabtme/godotto/pkg/regions
github.com/aybabtme/godotto/pkg/sizes
github.com/aybabtme/godotto/pkg/snapshots
github.com/aybabtme/godotto/pkg/tags
github.com/aybabtme/godotto/pkg/volumes
github.com/aybabtme/rgbterm
github.com/aybabtme/rgbterm/rainbow
github.com/aymerick/raymond
github.com/aymerick/raymond/ast
github.com/aymerick/raymond/handlebars
github.com/aymerick/raymond/lexer
github.com/aymerick/raymond/parser
github.com/beorn7/perks/histogram
github.com/beorn7/perks/quantile
github.com/beorn7/perks/topk
github.com/bep/gitmap
github.com/bep/inflect
github.com/bitly/go-nsq
github.com/bkaradzic/go-lz4
github.com/bkaradzic/go-lz4/fuzzer
github.com/bkaradzic/go-lz4/lz4-example
github.com/bmizerany/pat
github.com/bmizerany/pat/example
github.com/bmizerany/pat/example/patexample
github.com/bndr/gojenkins
github.com/boltdb/bolt
github.com/boltdb/bolt/cmd/bolt
github.com/bradfitz/iter
github.com/bradfitz/slice
github.com/bradleyfalzon/ghinstallation
github.com/bradleyfalzon/gopherci
github.com/bradleyfalzon/gopherci/internal/analyser
github.com/bradleyfalzon/gopherci/internal/db
github.com/bradleyfalzon/gopherci/internal/github
github.com/bradleyfalzon/gopherci/internal/logger
github.com/bradleyfalzon/gopherci/internal/queue
github.com/bradleyfalzon/gopherci/internal/web
github.com/bradleyfalzon/revgrep
github.com/bradleyfalzon/revgrep/cmd/revgrep
github.com/briandowns/spinner
github.com/caarlos0/ctrlc
github.com/calmh/xdr
github.com/calmh/xdr/cmd/genxdr
github.com/campoy/unique
github.com/cenk/backoff
github.com/cenkalti/backoff
github.com/certifi/gocertifi
github.com/chaseadamsio/goorgeous
github.com/cheggaaa/pb
github.com/christophberger/goman
github.com/chzyer/readline
github.com/chzyer/readline/example/readline-demo
github.com/chzyer/readline/example/readline-im
github.com/chzyer/readline/example/readline-multiline
github.com/chzyer/readline/example/readline-pass-strength
github.com/chzyer/readline/example/readline-remote/readline-remote-client
github.com/chzyer/readline/example/readline-remote/readline-remote-server
github.com/chzyer/readline/runes
github.com/clbanning/mxj
github.com/clbanning/mxj/examples
github.com/clbanning/mxj/j2x
github.com/clbanning/mxj/x2j
github.com/cloudflare/cfssl/api
github.com/cloudflare/cfssl/api/bundle
github.com/cloudflare/cfssl/api/certadd
github.com/cloudflare/cfssl/api/certinfo
github.com/cloudflare/cfssl/api/client
github.com/cloudflare/cfssl/api/crl
github.com/cloudflare/cfssl/api/gencrl
github.com/cloudflare/cfssl/api/generator
github.com/cloudflare/cfssl/api/info
github.com/cloudflare/cfssl/api/initca
github.com/cloudflare/cfssl/api/ocsp
github.com/cloudflare/cfssl/api/revoke
github.com/cloudflare/cfssl/api/scan
github.com/cloudflare/cfssl/api/sign
github.com/cloudflare/cfssl/api/signhandler
github.com/cloudflare/cfssl/auth
github.com/cloudflare/cfssl/bundler
github.com/cloudflare/cfssl/certdb
github.com/cloudflare/cfssl/certdb/dbconf
github.com/cloudflare/cfssl/certdb/ocspstapling
github.com/cloudflare/cfssl/certdb/sql
github.com/cloudflare/cfssl/certdb/testdb
github.com/cloudflare/cfssl/certinfo
github.com/cloudflare/cfssl/cli
github.com/cloudflare/cfssl/cli/bundle
github.com/cloudflare/cfssl/cli/certinfo
github.com/cloudflare/cfssl/cli/crl
github.com/cloudflare/cfssl/cli/gencert
github.com/cloudflare/cfssl/cli/gencrl
github.com/cloudflare/cfssl/cli/gencsr
github.com/cloudflare/cfssl/cli/genkey
github.com/cloudflare/cfssl/cli/info
github.com/cloudflare/cfssl/cli/ocspdump
github.com/cloudflare/cfssl/cli/ocsprefresh
github.com/cloudflare/cfssl/cli/ocspserve
github.com/cloudflare/cfssl/cli/ocspsign
github.com/cloudflare/cfssl/cli/printdefault
github.com/cloudflare/cfssl/cli/revoke
github.com/cloudflare/cfssl/cli/scan
github.com/cloudflare/cfssl/cli/selfsign
github.com/cloudflare/cfssl/cli/serve
github.com/cloudflare/cfssl/cli/sign
github.com/cloudflare/cfssl/cli/version
github.com/cloudflare/cfssl/cmd/cfssl
github.com/cloudflare/cfssl/cmd/cfssl-bundle
github.com/cloudflare/cfssl/cmd/cfssl-certinfo
github.com/cloudflare/cfssl/cmd/cfssl-newkey
github.com/cloudflare/cfssl/cmd/cfssl-scan
github.com/cloudflare/cfssl/cmd/cfssljson
github.com/cloudflare/cfssl/cmd/mkbundle
github.com/cloudflare/cfssl/cmd/multirootca
github.com/cloudflare/cfssl/config
github.com/cloudflare/cfssl/crl
github.com/cloudflare/cfssl/crypto
github.com/cloudflare/cfssl/crypto/pkcs7
github.com/cloudflare/cfssl/csr
github.com/cloudflare/cfssl/errors
github.com/cloudflare/cfssl/helpers
github.com/cloudflare/cfssl/helpers/derhelpers
github.com/cloudflare/cfssl/helpers/testsuite
github.com/cloudflare/cfssl/info
github.com/cloudflare/cfssl/initca
github.com/cloudflare/cfssl/log
github.com/cloudflare/cfssl/multiroot/config
github.com/cloudflare/cfssl/ocsp
github.com/cloudflare/cfssl/ocsp/config
github.com/cloudflare/cfssl/ocsp/universal
github.com/cloudflare/cfssl/revoke
github.com/cloudflare/cfssl/scan
github.com/cloudflare/cfssl/selfsign
github.com/cloudflare/cfssl/signer
github.com/cloudflare/cfssl/signer/local
github.com/cloudflare/cfssl/signer/remote
github.com/cloudflare/cfssl/signer/universal
github.com/cloudflare/cfssl/transport
github.com/cloudflare/cfssl/transport/ca
github.com/cloudflare/cfssl/transport/ca/localca
github.com/cloudflare/cfssl/transport/core
github.com/cloudflare/cfssl/transport/example/exlib
github.com/cloudflare/cfssl/transport/example/maclient
github.com/cloudflare/cfssl/transport/example/maserver
github.com/cloudflare/cfssl/transport/kp
github.com/cloudflare/cfssl/transport/roots
github.com/cloudflare/cfssl/transport/roots/system
github.com/cloudflare/cfssl/ubiquity
github.com/cloudflare/cfssl/whitelist
github.com/cloudflare/cfssl/whitelist/example
github.com/cockroachdb/cockroach-go/crdb
github.com/cockroachdb/cockroach-go/testserver
github.com/codegangsta/cli
github.com/codegangsta/cli/altsrc
github.com/codegangsta/negroni
github.com/constabulary/gb
github.com/constabulary/gb/cmd
github.com/constabulary/gb/cmd/gb
github.com/constabulary/gb/cmd/gb/internal/match
github.com/constabulary/gb/cmd/gb-vendor
github.com/constabulary/gb/internal/depfile
github.com/constabulary/gb/internal/fileutils
github.com/constabulary/gb/internal/untar
github.com/constabulary/gb/internal/vendor
github.com/constabulary/gb/internal/version
github.com/constabulary/gb/test
github.com/coreos/go-etcd/etcd
github.com/cortesi/modd
github.com/cortesi/modd/cmd/modd
github.com/cortesi/modd/conf
github.com/cortesi/modd/notify
github.com/cortesi/modd/shell
github.com/cortesi/modd/utils
github.com/cortesi/modd/varcmd
github.com/couchbase/go-couchbase
github.com/couchbase/go-couchbase/cbdatasource
github.com/couchbase/go-couchbase/cbdatasource/example
github.com/couchbase/go-couchbase/examples/basic
github.com/couchbase/go-couchbase/examples/bucketlist
github.com/couchbase/go-couchbase/examples/cb_auth
github.com/couchbase/go-couchbase/examples/failoverlog
github.com/couchbase/go-couchbase/examples/hello
github.com/couchbase/go-couchbase/examples/hello_getandtouch
github.com/couchbase/go-couchbase/examples/hello_observe
github.com/couchbase/go-couchbase/examples/hello_tap
github.com/couchbase/go-couchbase/examples/incr
github.com/couchbase/go-couchbase/examples/mb-15442
github.com/couchbase/go-couchbase/examples/observe
github.com/couchbase/go-couchbase/examples/streaming
github.com/couchbase/go-couchbase/examples/upr_bench
github.com/couchbase/go-couchbase/examples/upr_feed
github.com/couchbase/go-couchbase/examples/upr_restart
github.com/couchbase/go-couchbase/examples/view_params
github.com/couchbase/go-couchbase/perf
github.com/couchbase/go-couchbase/platform
github.com/couchbase/go-couchbase/platform/test
github.com/couchbase/go-couchbase/populate
github.com/couchbase/go-couchbase/tools/loadfile
github.com/couchbase/go-couchbase/tools/view2go
github.com/couchbase/go-couchbase/trace
github.com/couchbase/go-couchbase/util
github.com/couchbase/go_n1ql
github.com/couchbase/go_n1ql/examples/cas_example
github.com/couchbase/go_n1ql/examples/couchbase_example
github.com/couchbase/go_n1ql/examples/insert
github.com/couchbase/go_n1ql/examples/multicols
github.com/couchbase/go_n1ql/examples/ping
github.com/couchbase/go_n1ql/examples/simple_example
github.com/couchbase/go_n1ql/stress
github.com/couchbase/gomemcached
github.com/couchbase/gomemcached/client
github.com/couchbase/gomemcached/client/example
github.com/couchbase/gomemcached/client/mocks
github.com/couchbase/gomemcached/client/upr_example
github.com/couchbase/gomemcached/debug
github.com/couchbase/gomemcached/gocache
github.com/couchbase/gomemcached/server
github.com/couchbase/goutils/go-cbaudit
github.com/couchbase/goutils/logging
github.com/couchbase/goutils/platform
github.com/cpuguy83/go-md2man
github.com/cpuguy83/go-md2man/md2man
github.com/currantlabs/ble
github.com/currantlabs/ble/darwin
github.com/currantlabs/ble/examples/basic/advertiser
github.com/currantlabs/ble/examples/basic/explorer
github.com/currantlabs/ble/examples/basic/scanner
github.com/currantlabs/ble/examples/basic/server
github.com/currantlabs/ble/examples/blesh
github.com/currantlabs/ble/examples/lib
github.com/currantlabs/ble/examples/lib/dev
github.com/currantlabs/ble/linux
github.com/currantlabs/ble/linux/adv
github.com/currantlabs/ble/linux/att
github.com/currantlabs/ble/linux/gatt
github.com/currantlabs/ble/linux/hci
github.com/currantlabs/ble/linux/hci/cmd
github.com/currantlabs/ble/linux/hci/evt
github.com/currantlabs/ble/linux/hci/socket
github.com/currantlabs/ble/linux/tools/codegen
github.com/cweill/gotests
github.com/cweill/gotests/gotests
github.com/cweill/gotests/gotests/process
github.com/cweill/gotests/internal/goparser
github.com/cweill/gotests/internal/input
github.com/cweill/gotests/internal/models
github.com/cweill/gotests/internal/output
github.com/cweill/gotests/internal/render
github.com/cweill/gotests/internal/render/bindata
github.com/cznic/b
github.com/cznic/b/example
github.com/cznic/fileutil
github.com/cznic/fileutil/falloc
github.com/cznic/fileutil/hdb
github.com/cznic/fileutil/storage
github.com/cznic/golex
github.com/cznic/golex/lex
github.com/cznic/internal/buffer
github.com/cznic/internal/file
github.com/cznic/internal/slice
github.com/cznic/lldb
github.com/cznic/mathutil
github.com/cznic/mathutil/mersenne
github.com/cznic/ql
github.com/cznic/ql/design
github.com/cznic/ql/driver
github.com/cznic/ql/ql
github.com/cznic/ql/vendored/github.com/camlistore/go4/lock
github.com/cznic/sortutil
github.com/cznic/strutil
github.com/cznic/zappy
github.com/d4l3k/go-pry
github.com/d4l3k/go-pry/example/duplicated_exports
github.com/d4l3k/go-pry/example/file
github.com/d4l3k/go-pry/example/for-loop
github.com/d4l3k/go-pry/example/goroutine
github.com/d4l3k/go-pry/example/goroutines
github.com/d4l3k/go-pry/example/maps
github.com/d4l3k/go-pry/example/math
github.com/d4l3k/go-pry/example/packagealiases
github.com/d4l3k/go-pry/example/readme
github.com/d4l3k/go-pry/example/vendoring
github.com/d4l3k/go-pry/pry
github.com/d4l3k/go-pry/pry/safebuffer
github.com/daaku/go.zipexe
github.com/danwakefield/fnmatch
github.com/dave/gopackages
github.com/dave/jennifer
github.com/dave/jennifer/genjen
github.com/dave/jennifer/jen
github.com/dave/kerr
github.com/dave/kerr/kcov
github.com/dave/kerr/kcov/scanner
github.com/dave/kerr/kcov/tester
github.com/dave/kerr/kfmt
github.com/dave/kerr/ksrc
github.com/dave/rebecca
github.com/dave/rebecca/cmd/becca
github.com/dave/rebecca/testing
github.com/davecgh/go-spew/spew
github.com/davecgh/go-xdr/xdr
github.com/davecgh/go-xdr/xdr2
github.com/davelondon/gopackages
github.com/davelondon/kerr
github.com/davelondon/kerr/kcov
github.com/davelondon/kerr/kcov/scanner
github.com/davelondon/kerr/kcov/tester
github.com/davelondon/kerr/kfmt
github.com/davelondon/kerr/ksrc
github.com/davelondon/rebecca
github.com/davelondon/rebecca/cmd/becca
github.com/davelondon/rebecca/testing
github.com/daviddengcn/go-colortext
github.com/davidrjenni/reftools/cmd/fillstruct
github.com/davidrjenni/reftools/cmd/fillswitch
github.com/davidrjenni/reftools/cmd/fillswitch/test-fixtures/broken_typeswitch
github.com/davidrjenni/reftools/cmd/fillswitch/test-fixtures/empty_switch
github.com/davidrjenni/reftools/cmd/fillswitch/test-fixtures/switch_1
github.com/davidrjenni/reftools/cmd/fillswitch/test-fixtures/typeswitch_1
github.com/davidrjenni/reftools/cmd/fillswitch/test-fixtures/typeswitch_2
github.com/davidrjenni/reftools/cmd/fillswitch/test-fixtures/typeswitch_3
github.com/davidrjenni/reftools/cmd/fillswitch/test-fixtures/typeswitch_4
github.com/davidrjenni/reftools/cmd/fillswitch/test-fixtures/typeswitch_5
github.com/davidrjenni/reftools/cmd/fillswitch/test-fixtures/typeswitch_5/internal/foo
github.com/davidrjenni/reftools/cmd/fixplurals
github.com/dchest/cssmin
github.com/denisenkom/go-mssqldb
github.com/denisenkom/go-mssqldb/batch
github.com/denisenkom/go-mssqldb/examples/bulk
github.com/denisenkom/go-mssqldb/examples/simple
github.com/denisenkom/go-mssqldb/examples/tsql
github.com/derekparker/delve/cmd/dlv
github.com/derekparker/delve/cmd/dlv/cmds
github.com/derekparker/delve/pkg/config
github.com/derekparker/delve/pkg/dwarf/dwarfbuilder
github.com/derekparker/delve/pkg/dwarf/frame
github.com/derekparker/delve/pkg/dwarf/godwarf
github.com/derekparker/delve/pkg/dwarf/line
github.com/derekparker/delve/pkg/dwarf/op
github.com/derekparker/delve/pkg/dwarf/reader
github.com/derekparker/delve/pkg/dwarf/util
github.com/derekparker/delve/pkg/goversion
github.com/derekparker/delve/pkg/proc
github.com/derekparker/delve/pkg/proc/core
github.com/derekparker/delve/pkg/proc/gdbserial
github.com/derekparker/delve/pkg/proc/native
github.com/derekparker/delve/pkg/proc/test
github.com/derekparker/delve/pkg/terminal
github.com/derekparker/delve/pkg/version
github.com/derekparker/delve/scripts
github.com/derekparker/delve/service
github.com/derekparker/delve/service/api
github.com/derekparker/delve/service/debugger
github.com/derekparker/delve/service/rpc1
github.com/derekparker/delve/service/rpc2
github.com/derekparker/delve/service/rpccommon
github.com/derekparker/delve/service/test
github.com/derekparker/delve/service/test/cmd
github.com/dgrijalva/jwt-go
github.com/dgrijalva/jwt-go/cmd/jwt
github.com/dgrijalva/jwt-go/request
github.com/dgrijalva/jwt-go/test
github.com/dhiltgen/docker-machine-kvm
github.com/dhiltgen/docker-machine-kvm/cmd/docker-machine-driver-kvm
github.com/didip/shawty
github.com/didip/shawty/handlers
github.com/didip/shawty/storages
github.com/digitalocean/doctl
github.com/digitalocean/doctl/cmd/doctl
github.com/digitalocean/doctl/cmd/doctl-gen-doc
github.com/digitalocean/doctl/cmd/install-doctl
github.com/digitalocean/doctl/cmd/release-doctl
github.com/digitalocean/doctl/commands
github.com/digitalocean/doctl/do
github.com/digitalocean/doctl/do/mocks
github.com/digitalocean/doctl/install
github.com/digitalocean/doctl/pkg/runner
github.com/digitalocean/doctl/pkg/runner/mocks
github.com/digitalocean/doctl/pkg/ssh
github.com/digitalocean/doctl/pkg/system
github.com/digitalocean/doctl/pkg/units
github.com/digitalocean/doctl/pluginhost
github.com/disintegration/imaging
github.com/dlclark/regexp2
github.com/dlclark/regexp2/syntax
github.com/docker/cli/cli
github.com/docker/cli/cli/command
github.com/docker/cli/cli/command/bundlefile
github.com/docker/cli/cli/command/checkpoint
github.com/docker/cli/cli/command/commands
github.com/docker/cli/cli/command/config
github.com/docker/cli/cli/command/container
github.com/docker/cli/cli/command/formatter
github.com/docker/cli/cli/command/idresolver
github.com/docker/cli/cli/command/image
github.com/docker/cli/cli/command/image/build
github.com/docker/cli/cli/command/inspect
github.com/docker/cli/cli/command/manifest
github.com/docker/cli/cli/command/network
github.com/docker/cli/cli/command/node
github.com/docker/cli/cli/command/plugin
github.com/docker/cli/cli/command/registry
github.com/docker/cli/cli/command/secret
github.com/docker/cli/cli/command/service
github.com/docker/cli/cli/command/service/progress
github.com/docker/cli/cli/command/stack
github.com/docker/cli/cli/command/stack/kubernetes
github.com/docker/cli/cli/command/stack/options
github.com/docker/cli/cli/command/stack/swarm
github.com/docker/cli/cli/command/swarm
github.com/docker/cli/cli/command/swarm/progress
github.com/docker/cli/cli/command/system
github.com/docker/cli/cli/command/task
github.com/docker/cli/cli/command/trust
github.com/docker/cli/cli/command/volume
github.com/docker/cli/cli/compose/convert
github.com/docker/cli/cli/compose/interpolation
github.com/docker/cli/cli/compose/loader
github.com/docker/cli/cli/compose/schema
github.com/docker/cli/cli/compose/template
github.com/docker/cli/cli/compose/types
github.com/docker/cli/cli/config
github.com/docker/cli/cli/config/configfile
github.com/docker/cli/cli/config/credentials
github.com/docker/cli/cli/debug
github.com/docker/cli/cli/flags
github.com/docker/cli/cli/manifest/store
github.com/docker/cli/cli/manifest/types
github.com/docker/cli/cli/registry/client
github.com/docker/cli/cli/trust
github.com/docker/cli/cmd/docker
github.com/docker/cli/docs/yaml
github.com/docker/cli/e2e/container
github.com/docker/cli/e2e/image
github.com/docker/cli/e2e/internal/fixtures
github.com/docker/cli/e2e/stack
github.com/docker/cli/e2e/trust
github.com/docker/cli/internal/test
github.com/docker/cli/internal/test/builders
github.com/docker/cli/internal/test/environment
github.com/docker/cli/internal/test/network
github.com/docker/cli/internal/test/testutil
github.com/docker/cli/kubernetes
github.com/docker/cli/kubernetes/client/clientset_generated/clientset
github.com/docker/cli/kubernetes/client/clientset_generated/clientset/scheme
github.com/docker/cli/kubernetes/client/clientset_generated/clientset/typed/compose/v1beta1
github.com/docker/cli/kubernetes/compose
github.com/docker/cli/kubernetes/compose/v1beta1
github.com/docker/cli/kubernetes/labels
github.com/docker/cli/man
github.com/docker/cli/opts
github.com/docker/cli/service/logs
github.com/docker/cli/templates
github.com/docker/docker/api
github.com/docker/docker/api/server
github.com/docker/docker/api/server/backend/build
github.com/docker/docker/api/server/httputils
github.com/docker/docker/api/server/middleware
github.com/docker/docker/api/server/router
github.com/docker/docker/api/server/router/build
github.com/docker/docker/api/server/router/checkpoint
github.com/docker/docker/api/server/router/container
github.com/docker/docker/api/server/router/debug
github.com/docker/docker/api/server/router/distribution
github.com/docker/docker/api/server/router/image
github.com/docker/docker/api/server/router/network
github.com/docker/docker/api/server/router/plugin
github.com/docker/docker/api/server/router/session
github.com/docker/docker/api/server/router/swarm
github.com/docker/docker/api/server/router/system
github.com/docker/docker/api/server/router/volume
github.com/docker/docker/api/types
github.com/docker/docker/api/types/backend
github.com/docker/docker/api/types/blkiodev
github.com/docker/docker/api/types/container
github.com/docker/docker/api/types/events
github.com/docker/docker/api/types/filters
github.com/docker/docker/api/types/image
github.com/docker/docker/api/types/mount
github.com/docker/docker/api/types/network
github.com/docker/docker/api/types/plugins/logdriver
github.com/docker/docker/api/types/registry
github.com/docker/docker/api/types/strslice
github.com/docker/docker/api/types/swarm
github.com/docker/docker/api/types/swarm/runtime
github.com/docker/docker/api/types/time
github.com/docker/docker/api/types/versions
github.com/docker/docker/api/types/versions/v1p19
github.com/docker/docker/api/types/versions/v1p20
github.com/docker/docker/api/types/volume
github.com/docker/docker/builder
github.com/docker/docker/builder/dockerfile
github.com/docker/docker/builder/dockerfile/command
github.com/docker/docker/builder/dockerfile/instructions
github.com/docker/docker/builder/dockerfile/parser
github.com/docker/docker/builder/dockerfile/parser/dumper
github.com/docker/docker/builder/dockerignore
github.com/docker/docker/builder/fscache
github.com/docker/docker/builder/remotecontext
github.com/docker/docker/builder/remotecontext/git
github.com/docker/docker/cli
github.com/docker/docker/cli/config
github.com/docker/docker/cli/debug
github.com/docker/docker/client
github.com/docker/docker/cmd/dockerd
github.com/docker/docker/cmd/dockerd/hack
github.com/docker/docker/container
github.com/docker/docker/container/stream
github.com/docker/docker/contrib/apparmor
github.com/docker/docker/contrib/docker-device-tool
github.com/docker/docker/contrib/httpserver
github.com/docker/docker/daemon
github.com/docker/docker/daemon/caps
github.com/docker/docker/daemon/cluster
github.com/docker/docker/daemon/cluster/controllers/plugin
github.com/docker/docker/daemon/cluster/convert
github.com/docker/docker/daemon/cluster/executor
github.com/docker/docker/daemon/cluster/executor/container
github.com/docker/docker/daemon/cluster/provider
github.com/docker/docker/daemon/config
github.com/docker/docker/daemon/discovery
github.com/docker/docker/daemon/events
github.com/docker/docker/daemon/events/testutils
github.com/docker/docker/daemon/exec
github.com/docker/docker/daemon/graphdriver
github.com/docker/docker/daemon/graphdriver/aufs
github.com/docker/docker/daemon/graphdriver/btrfs
github.com/docker/docker/daemon/graphdriver/copy
github.com/docker/docker/daemon/graphdriver/devmapper
github.com/docker/docker/daemon/graphdriver/graphtest
github.com/docker/docker/daemon/graphdriver/overlay
github.com/docker/docker/daemon/graphdriver/overlay2
github.com/docker/docker/daemon/graphdriver/overlayutils
github.com/docker/docker/daemon/graphdriver/quota
github.com/docker/docker/daemon/graphdriver/register
github.com/docker/docker/daemon/graphdriver/vfs
github.com/docker/docker/daemon/graphdriver/zfs
github.com/docker/docker/daemon/initlayer
github.com/docker/docker/daemon/links
github.com/docker/docker/daemon/listeners
github.com/docker/docker/daemon/logger
github.com/docker/docker/daemon/logger/awslogs
github.com/docker/docker/daemon/logger/fluentd
github.com/docker/docker/daemon/logger/gcplogs
github.com/docker/docker/daemon/logger/gelf
github.com/docker/docker/daemon/logger/journald
github.com/docker/docker/daemon/logger/jsonfilelog
github.com/docker/docker/daemon/logger/jsonfilelog/jsonlog
github.com/docker/docker/daemon/logger/logentries
github.com/docker/docker/daemon/logger/loggerutils
github.com/docker/docker/daemon/logger/loggerutils/multireader
github.com/docker/docker/daemon/logger/splunk
github.com/docker/docker/daemon/logger/syslog
github.com/docker/docker/daemon/logger/templates
github.com/docker/docker/daemon/names
github.com/docker/docker/daemon/network
github.com/docker/docker/daemon/stats
github.com/docker/docker/distribution
github.com/docker/docker/distribution/metadata
github.com/docker/docker/distribution/utils
github.com/docker/docker/distribution/xfer
github.com/docker/docker/dockerversion
github.com/docker/docker/errdefs
github.com/docker/docker/hack/integration-cli-on-swarm/agent/master
github.com/docker/docker/hack/integration-cli-on-swarm/agent/types
github.com/docker/docker/hack/integration-cli-on-swarm/agent/worker
github.com/docker/docker/hack/integration-cli-on-swarm/host
github.com/docker/docker/image
github.com/docker/docker/image/cache
github.com/docker/docker/image/tarexport
github.com/docker/docker/image/v1
github.com/docker/docker/integration
github.com/docker/docker/integration/build
github.com/docker/docker/integration/container
github.com/docker/docker/integration/image
github.com/docker/docker/integration/network
github.com/docker/docker/integration/plugin
github.com/docker/docker/integration/plugin/authz
github.com/docker/docker/integration/service
github.com/docker/docker/integration/system
github.com/docker/docker/integration/util/request
github.com/docker/docker/integration/util/requirement
github.com/docker/docker/integration-cli
github.com/docker/docker/integration-cli/checker
github.com/docker/docker/integration-cli/cli
github.com/docker/docker/integration-cli/cli/build
github.com/docker/docker/integration-cli/cli/build/fakecontext
github.com/docker/docker/integration-cli/cli/build/fakegit
github.com/docker/docker/integration-cli/cli/build/fakestorage
github.com/docker/docker/integration-cli/daemon
github.com/docker/docker/integration-cli/environment
github.com/docker/docker/integration-cli/fixtures/load
github.com/docker/docker/integration-cli/fixtures/plugin
github.com/docker/docker/integration-cli/fixtures/plugin/basic
github.com/docker/docker/integration-cli/registry
github.com/docker/docker/integration-cli/request
github.com/docker/docker/integration-cli/requirement
github.com/docker/docker/internal/test/environment
github.com/docker/docker/internal/testutil
github.com/docker/docker/layer
github.com/docker/docker/libcontainerd
github.com/docker/docker/migrate/v1
github.com/docker/docker/oci
github.com/docker/docker/opts
github.com/docker/docker/pkg/aaparser
github.com/docker/docker/pkg/archive
github.com/docker/docker/pkg/authorization
github.com/docker/docker/pkg/broadcaster
github.com/docker/docker/pkg/chrootarchive
github.com/docker/docker/pkg/containerfs
github.com/docker/docker/pkg/devicemapper
github.com/docker/docker/pkg/directory
github.com/docker/docker/pkg/discovery
github.com/docker/docker/pkg/discovery/file
github.com/docker/docker/pkg/discovery/kv
github.com/docker/docker/pkg/discovery/memory
github.com/docker/docker/pkg/discovery/nodes
github.com/docker/docker/pkg/dmesg
github.com/docker/docker/pkg/filenotify
github.com/docker/docker/pkg/fileutils
github.com/docker/docker/pkg/fsutils
github.com/docker/docker/pkg/homedir
github.com/docker/docker/pkg/idtools
github.com/docker/docker/pkg/ioutils
github.com/docker/docker/pkg/jsonmessage
github.com/docker/docker/pkg/locker
github.com/docker/docker/pkg/longpath
github.com/docker/docker/pkg/loopback
github.com/docker/docker/pkg/mount
github.com/docker/docker/pkg/namesgenerator
github.com/docker/docker/pkg/namesgenerator/cmd/names-generator
github.com/docker/docker/pkg/parsers
github.com/docker/docker/pkg/parsers/kernel
github.com/docker/docker/pkg/parsers/operatingsystem
github.com/docker/docker/pkg/pidfile
github.com/docker/docker/pkg/platform
github.com/docker/docker/pkg/plugingetter
github.com/docker/docker/pkg/plugins
github.com/docker/docker/pkg/plugins/pluginrpc-gen
github.com/docker/docker/pkg/plugins/pluginrpc-gen/fixtures
github.com/docker/docker/pkg/plugins/pluginrpc-gen/fixtures/otherfixture
github.com/docker/docker/pkg/plugins/transport
github.com/docker/docker/pkg/pools
github.com/docker/docker/pkg/progress
github.com/docker/docker/pkg/pubsub
github.com/docker/docker/pkg/reexec
github.com/docker/docker/pkg/signal
github.com/docker/docker/pkg/signal/testfiles
github.com/docker/docker/pkg/stdcopy
github.com/docker/docker/pkg/streamformatter
github.com/docker/docker/pkg/stringid
github.com/docker/docker/pkg/symlink
github.com/docker/docker/pkg/sysinfo
github.com/docker/docker/pkg/system
github.com/docker/docker/pkg/tailfile
github.com/docker/docker/pkg/tarsum
github.com/docker/docker/pkg/term
github.com/docker/docker/pkg/term/windows
github.com/docker/docker/pkg/truncindex
github.com/docker/docker/pkg/urlutil
github.com/docker/docker/pkg/useragent
github.com/docker/docker/plugin
github.com/docker/docker/plugin/executor/containerd
github.com/docker/docker/plugin/v2
github.com/docker/docker/profiles/apparmor
github.com/docker/docker/profiles/seccomp
github.com/docker/docker/reference
github.com/docker/docker/registry
github.com/docker/docker/registry/resumable
github.com/docker/docker/restartmanager
github.com/docker/docker/runconfig
github.com/docker/docker/runconfig/opts
github.com/docker/docker/volume
github.com/docker/docker/volume/drivers
github.com/docker/docker/volume/local
github.com/docker/docker/volume/store
github.com/docker/docker/volume/testutils
github.com/docker/docker-credential-helpers/client
github.com/docker/docker-credential-helpers/credentials
github.com/docker/docker-credential-helpers/osxkeychain
github.com/docker/docker-credential-helpers/pass
github.com/docker/docker-credential-helpers/pass/cmd
github.com/docker/docker-credential-helpers/secretservice
github.com/docker/docker-credential-helpers/secretservice/cmd
github.com/docker/go-connections
github.com/docker/go-connections/nat
github.com/docker/go-connections/proxy
github.com/docker/go-connections/sockets
github.com/docker/go-connections/tlsconfig
github.com/docker/go-units
github.com/docker/libnetwork
github.com/docker/libnetwork/api
github.com/docker/libnetwork/bitseq
github.com/docker/libnetwork/client
github.com/docker/libnetwork/client/mflag
github.com/docker/libnetwork/client/mflag/example
github.com/docker/libnetwork/cluster
github.com/docker/libnetwork/cmd/dnet
github.com/docker/libnetwork/cmd/ovrouter
github.com/docker/libnetwork/cmd/proxy
github.com/docker/libnetwork/cmd/readme_test
github.com/docker/libnetwork/common
github.com/docker/libnetwork/config
github.com/docker/libnetwork/datastore
github.com/docker/libnetwork/diagnose
github.com/docker/libnetwork/discoverapi
github.com/docker/libnetwork/driverapi
github.com/docker/libnetwork/drivers/bridge
github.com/docker/libnetwork/drivers/bridge/brmanager
github.com/docker/libnetwork/drivers/host
github.com/docker/libnetwork/drivers/ipvlan
github.com/docker/libnetwork/drivers/ipvlan/ivmanager
github.com/docker/libnetwork/drivers/macvlan
github.com/docker/libnetwork/drivers/macvlan/mvmanager
github.com/docker/libnetwork/drivers/null
github.com/docker/libnetwork/drivers/overlay
github.com/docker/libnetwork/drivers/overlay/ovmanager
github.com/docker/libnetwork/drivers/remote
github.com/docker/libnetwork/drivers/remote/api
github.com/docker/libnetwork/drivers/windows
github.com/docker/libnetwork/drivers/windows/overlay
github.com/docker/libnetwork/drvregistry
github.com/docker/libnetwork/etchosts
github.com/docker/libnetwork/hostdiscovery
github.com/docker/libnetwork/idm
github.com/docker/libnetwork/ipam
github.com/docker/libnetwork/ipamapi
github.com/docker/libnetwork/ipams/builtin
github.com/docker/libnetwork/ipams/null
github.com/docker/libnetwork/ipams/remote
github.com/docker/libnetwork/ipams/remote/api
github.com/docker/libnetwork/ipams/windowsipam
github.com/docker/libnetwork/ipamutils
github.com/docker/libnetwork/iptables
github.com/docker/libnetwork/ipvs
github.com/docker/libnetwork/netlabel
github.com/docker/libnetwork/netutils
github.com/docker/libnetwork/networkdb
github.com/docker/libnetwork/ns
github.com/docker/libnetwork/options
github.com/docker/libnetwork/osl
github.com/docker/libnetwork/portallocator
github.com/docker/libnetwork/portmapper
github.com/docker/libnetwork/resolvconf
github.com/docker/libnetwork/resolvconf/dns
github.com/docker/libnetwork/test/networkDb
github.com/docker/libnetwork/test/networkDb/dbclient
github.com/docker/libnetwork/test/networkDb/dbserver
github.com/docker/libnetwork/test/networkDb/dummyclient
github.com/docker/libnetwork/testutils
github.com/docker/libnetwork/types
github.com/docker/libtrust
github.com/docker/libtrust/testutil
github.com/docker/libtrust/tlsdemo
github.com/docker/libtrust/trustgraph
github.com/docker/machine
github.com/docker/machine/cmd
github.com/docker/machine/commands
github.com/docker/machine/commands/commandstest
github.com/docker/machine/commands/mcndirs
github.com/docker/machine/drivers/amazonec2
github.com/docker/machine/drivers/azure
github.com/docker/machine/drivers/azure/azureutil
github.com/docker/machine/drivers/azure/logutil
github.com/docker/machine/drivers/digitalocean
github.com/docker/machine/drivers/driverutil
github.com/docker/machine/drivers/errdriver
github.com/docker/machine/drivers/exoscale
github.com/docker/machine/drivers/fakedriver
github.com/docker/machine/drivers/generic
github.com/docker/machine/drivers/google
github.com/docker/machine/drivers/hyperv
github.com/docker/machine/drivers/none
github.com/docker/machine/drivers/openstack
github.com/docker/machine/drivers/rackspace
github.com/docker/machine/drivers/softlayer
github.com/docker/machine/drivers/virtualbox
github.com/docker/machine/drivers/vmwarefusion
github.com/docker/machine/drivers/vmwarevcloudair
github.com/docker/machine/drivers/vmwarevsphere
github.com/docker/machine/its
github.com/docker/machine/its/cli
github.com/docker/machine/its/thirdparty
github.com/docker/machine/libmachine
github.com/docker/machine/libmachine/auth
github.com/docker/machine/libmachine/cert
github.com/docker/machine/libmachine/check
github.com/docker/machine/libmachine/crashreport
github.com/docker/machine/libmachine/drivers
github.com/docker/machine/libmachine/drivers/plugin
github.com/docker/machine/libmachine/drivers/plugin/localbinary
github.com/docker/machine/libmachine/drivers/rpc
github.com/docker/machine/libmachine/engine
github.com/docker/machine/libmachine/examples
github.com/docker/machine/libmachine/host
github.com/docker/machine/libmachine/hosttest
github.com/docker/machine/libmachine/libmachinetest
github.com/docker/machine/libmachine/log
github.com/docker/machine/libmachine/mcndockerclient
github.com/docker/machine/libmachine/mcnerror
github.com/docker/machine/libmachine/mcnflag
github.com/docker/machine/libmachine/mcnutils
github.com/docker/machine/libmachine/persist
github.com/docker/machine/libmachine/persist/persisttest
github.com/docker/machine/libmachine/provider
github.com/docker/machine/libmachine/provision
github.com/docker/machine/libmachine/provision/pkgaction
github.com/docker/machine/libmachine/provision/provisiontest
github.com/docker/machine/libmachine/provision/serviceaction
github.com/docker/machine/libmachine/shell
github.com/docker/machine/libmachine/ssh
github.com/docker/machine/libmachine/ssh/sshtest
github.com/docker/machine/libmachine/state
github.com/docker/machine/libmachine/swarm
github.com/docker/machine/libmachine/version
github.com/docker/machine/libmachine/versioncmp
github.com/docker/machine/version
github.com/docker/notary
github.com/docker/notary/client
github.com/docker/notary/client/changelist
github.com/docker/notary/cmd/escrow
github.com/docker/notary/cmd/notary
github.com/docker/notary/cmd/notary-server
github.com/docker/notary/cmd/notary-signer
github.com/docker/notary/cryptoservice
github.com/docker/notary/passphrase
github.com/docker/notary/proto
github.com/docker/notary/server
github.com/docker/notary/server/errors
github.com/docker/notary/server/handlers
github.com/docker/notary/server/snapshot
github.com/docker/notary/server/storage
github.com/docker/notary/server/timestamp
github.com/docker/notary/signer
github.com/docker/notary/signer/api
github.com/docker/notary/signer/client
github.com/docker/notary/signer/keydbstore
github.com/docker/notary/storage
github.com/docker/notary/storage/rethinkdb
github.com/docker/notary/trustmanager
github.com/docker/notary/trustmanager/remoteks
github.com/docker/notary/trustmanager/yubikey
github.com/docker/notary/trustpinning
github.com/docker/notary/tuf
github.com/docker/notary/tuf/data
github.com/docker/notary/tuf/signed
github.com/docker/notary/tuf/testutils
github.com/docker/notary/tuf/testutils/interfaces
github.com/docker/notary/tuf/testutils/keys
github.com/docker/notary/tuf/utils
github.com/docker/notary/tuf/validation
github.com/docker/notary/utils
github.com/docker/notary/version
github.com/dominikh/go-tools/cmd/keyify
github.com/dominikh/go-tools/cmd/rdeps
github.com/dominikh/go-tools/cmd/structlayout
github.com/dominikh/go-tools/cmd/structlayout-optimize
github.com/dominikh/go-tools/cmd/structlayout-pretty
github.com/dominikh/go-tools/deprecated
github.com/dominikh/go-tools/errcheck
github.com/dominikh/go-tools/functions
github.com/dominikh/go-tools/internal/sharedcheck
github.com/dominikh/go-tools/staticcheck/vrp
github.com/dominikh/go-tools/structlayout
github.com/dominikh/go-tools/version
github.com/donovanhide/eventsource
github.com/drhodes/golorem
github.com/dsnet/compress
github.com/dsnet/compress/brotli
github.com/dsnet/compress/bzip2
github.com/dsnet/compress/bzip2/internal/sais
github.com/dsnet/compress/flate
github.com/dsnet/compress/internal
github.com/dsnet/compress/internal/cgo/brotli
github.com/dsnet/compress/internal/cgo/bzip2
github.com/dsnet/compress/internal/cgo/flate
github.com/dsnet/compress/internal/cgo/lzma
github.com/dsnet/compress/internal/cgo/zstd
github.com/dsnet/compress/internal/errors
github.com/dsnet/compress/internal/prefix
github.com/dsnet/compress/internal/testutil
github.com/dsnet/compress/internal/tool/bench
github.com/dsnet/compress/internal/tool/bitgen
github.com/dsnet/compress/xflate
github.com/dsnet/compress/xflate/internal/meta
github.com/dustin/go-humanize
github.com/dustin/go-humanize/english
github.com/eclipse/paho.mqtt.golang
github.com/eclipse/paho.mqtt.golang/cmd/custom_store
github.com/eclipse/paho.mqtt.golang/cmd/routing
github.com/eclipse/paho.mqtt.golang/cmd/sample
github.com/eclipse/paho.mqtt.golang/cmd/simple
github.com/eclipse/paho.mqtt.golang/cmd/ssl
github.com/eclipse/paho.mqtt.golang/cmd/stdinpub
github.com/eclipse/paho.mqtt.golang/cmd/stdoutsub
github.com/eclipse/paho.mqtt.golang/packets
github.com/edsrzf/mmap-go
github.com/ejcx/passgo
github.com/ejcx/passgo/edit
github.com/ejcx/passgo/generate
github.com/ejcx/passgo/initialize
github.com/ejcx/passgo/insert
github.com/ejcx/passgo/pc
github.com/ejcx/passgo/pio
github.com/ejcx/passgo/show
github.com/ejcx/passgo/sync
github.com/eknkc/amber
github.com/eknkc/amber/amberc
github.com/eknkc/amber/parser
github.com/evalphobia/logrus_sentry
github.com/facebookgo/ensure
github.com/facebookgo/inject
github.com/facebookgo/inject/injecttesta
github.com/facebookgo/inject/injecttestb
github.com/facebookgo/stack
github.com/facebookgo/structtag
github.com/facebookgo/subset
github.com/fatih/color
github.com/fatih/gomodifytags
github.com/fatih/motion
github.com/fatih/motion/astcontext
github.com/fatih/motion/vim
github.com/fatih/structs
github.com/fatih/structtag
github.com/flynn/go-shlex
github.com/flynn-archive/go-shlex
github.com/fogleman/gg
github.com/fogleman/gg/examples
github.com/fogleman/primitive
github.com/fogleman/primitive/primitive
github.com/fsnotify/fsnotify
github.com/fsouza/go-dockerclient
github.com/fsouza/go-dockerclient/testing
github.com/future-architect/vuls
github.com/future-architect/vuls/cache
github.com/future-architect/vuls/commands
github.com/future-architect/vuls/config
github.com/future-architect/vuls/contrib/owasp-dependency-check/parser
github.com/future-architect/vuls/models
github.com/future-architect/vuls/oval
github.com/future-architect/vuls/report
github.com/future-architect/vuls/scan
github.com/future-architect/vuls/util
github.com/gchaincl/httplab
github.com/gchaincl/httplab/cmd/httplab
github.com/gchaincl/httplab/ui
github.com/gdumoulin/goebcdic
github.com/geoffgarside/ber
github.com/getsentry/raven-go
github.com/getsentry/raven-go/example
github.com/ghodss/yaml
github.com/gilbertchen/azure-sdk-for-go/Gododir
github.com/gilbertchen/azure-sdk-for-go/arm/advisor
github.com/gilbertchen/azure-sdk-for-go/arm/analysisservices
github.com/gilbertchen/azure-sdk-for-go/arm/apimanagement
github.com/gilbertchen/azure-sdk-for-go/arm/apimdeployment
github.com/gilbertchen/azure-sdk-for-go/arm/appinsights
github.com/gilbertchen/azure-sdk-for-go/arm/authorization
github.com/gilbertchen/azure-sdk-for-go/arm/automation
github.com/gilbertchen/azure-sdk-for-go/arm/batch
github.com/gilbertchen/azure-sdk-for-go/arm/billing
github.com/gilbertchen/azure-sdk-for-go/arm/cdn
github.com/gilbertchen/azure-sdk-for-go/arm/cognitiveservices
github.com/gilbertchen/azure-sdk-for-go/arm/commerce
github.com/gilbertchen/azure-sdk-for-go/arm/compute
github.com/gilbertchen/azure-sdk-for-go/arm/consumption
github.com/gilbertchen/azure-sdk-for-go/arm/containerregistry
github.com/gilbertchen/azure-sdk-for-go/arm/containerservice
github.com/gilbertchen/azure-sdk-for-go/arm/cosmos-db
github.com/gilbertchen/azure-sdk-for-go/arm/customer-insights
github.com/gilbertchen/azure-sdk-for-go/arm/datalake-analytics/account
github.com/gilbertchen/azure-sdk-for-go/arm/datalake-store/account
github.com/gilbertchen/azure-sdk-for-go/arm/devtestlabs
github.com/gilbertchen/azure-sdk-for-go/arm/disk
github.com/gilbertchen/azure-sdk-for-go/arm/dns
github.com/gilbertchen/azure-sdk-for-go/arm/documentdb
github.com/gilbertchen/azure-sdk-for-go/arm/eventhub
github.com/gilbertchen/azure-sdk-for-go/arm/examples/check
github.com/gilbertchen/azure-sdk-for-go/arm/examples/create
github.com/gilbertchen/azure-sdk-for-go/arm/examples/dns
github.com/gilbertchen/azure-sdk-for-go/arm/examples/dns/paging
github.com/gilbertchen/azure-sdk-for-go/arm/examples/helpers
github.com/gilbertchen/azure-sdk-for-go/arm/graphrbac
github.com/gilbertchen/azure-sdk-for-go/arm/hdinsight
github.com/gilbertchen/azure-sdk-for-go/arm/insights
github.com/gilbertchen/azure-sdk-for-go/arm/intune
github.com/gilbertchen/azure-sdk-for-go/arm/iothub
github.com/gilbertchen/azure-sdk-for-go/arm/keyvault
github.com/gilbertchen/azure-sdk-for-go/arm/logic
github.com/gilbertchen/azure-sdk-for-go/arm/machinelearning/commitmentplans
github.com/gilbertchen/azure-sdk-for-go/arm/machinelearning/webservices
github.com/gilbertchen/azure-sdk-for-go/arm/mediaservices
github.com/gilbertchen/azure-sdk-for-go/arm/mobileengagement
github.com/gilbertchen/azure-sdk-for-go/arm/monitor
github.com/gilbertchen/azure-sdk-for-go/arm/mysql
github.com/gilbertchen/azure-sdk-for-go/arm/network
github.com/gilbertchen/azure-sdk-for-go/arm/networkwatcher
github.com/gilbertchen/azure-sdk-for-go/arm/notificationhubs
github.com/gilbertchen/azure-sdk-for-go/arm/operationalinsights
github.com/gilbertchen/azure-sdk-for-go/arm/postgresql
github.com/gilbertchen/azure-sdk-for-go/arm/powerbiembedded
github.com/gilbertchen/azure-sdk-for-go/arm/recoveryservices
github.com/gilbertchen/azure-sdk-for-go/arm/recoveryservicesbackup
github.com/gilbertchen/azure-sdk-for-go/arm/recoveryservicessiterecovery
github.com/gilbertchen/azure-sdk-for-go/arm/redis
github.com/gilbertchen/azure-sdk-for-go/arm/relay
github.com/gilbertchen/azure-sdk-for-go/arm/resourcehealth
github.com/gilbertchen/azure-sdk-for-go/arm/resources/features
github.com/gilbertchen/azure-sdk-for-go/arm/resources/links
github.com/gilbertchen/azure-sdk-for-go/arm/resources/locks
github.com/gilbertchen/azure-sdk-for-go/arm/resources/managedapplications
github.com/gilbertchen/azure-sdk-for-go/arm/resources/policy
github.com/gilbertchen/azure-sdk-for-go/arm/resources/resources
github.com/gilbertchen/azure-sdk-for-go/arm/resources/subscriptions
github.com/gilbertchen/azure-sdk-for-go/arm/scheduler
github.com/gilbertchen/azure-sdk-for-go/arm/search
github.com/gilbertchen/azure-sdk-for-go/arm/servermanagement
github.com/gilbertchen/azure-sdk-for-go/arm/service-map
github.com/gilbertchen/azure-sdk-for-go/arm/servicebus
github.com/gilbertchen/azure-sdk-for-go/arm/servicefabric
github.com/gilbertchen/azure-sdk-for-go/arm/sql
github.com/gilbertchen/azure-sdk-for-go/arm/storage
github.com/gilbertchen/azure-sdk-for-go/arm/storageimportexport
github.com/gilbertchen/azure-sdk-for-go/arm/storsimple8000series
github.com/gilbertchen/azure-sdk-for-go/arm/streamanalytics
github.com/gilbertchen/azure-sdk-for-go/arm/trafficmanager
github.com/gilbertchen/azure-sdk-for-go/arm/web
github.com/gilbertchen/azure-sdk-for-go/datalake-store/filesystem
github.com/gilbertchen/azure-sdk-for-go/dataplane/keyvault
github.com/gilbertchen/azure-sdk-for-go/management
github.com/gilbertchen/azure-sdk-for-go/management/affinitygroup
github.com/gilbertchen/azure-sdk-for-go/management/hostedservice
github.com/gilbertchen/azure-sdk-for-go/management/location
github.com/gilbertchen/azure-sdk-for-go/management/networksecuritygroup
github.com/gilbertchen/azure-sdk-for-go/management/osimage
github.com/gilbertchen/azure-sdk-for-go/management/sql
github.com/gilbertchen/azure-sdk-for-go/management/storageservice
github.com/gilbertchen/azure-sdk-for-go/management/testutils
github.com/gilbertchen/azure-sdk-for-go/management/virtualmachine
github.com/gilbertchen/azure-sdk-for-go/management/virtualmachinedisk
github.com/gilbertchen/azure-sdk-for-go/management/virtualmachineimage
github.com/gilbertchen/azure-sdk-for-go/management/virtualnetwork
github.com/gilbertchen/azure-sdk-for-go/management/vmutils
github.com/gilbertchen/azure-sdk-for-go/storage
github.com/gilbertchen/cli
github.com/gilbertchen/duplicacy/duplicacy
github.com/gilbertchen/duplicacy/src
github.com/gilbertchen/go-dropbox
github.com/gilbertchen/go.dbus
github.com/gilbertchen/go.dbus/introspect
github.com/gilbertchen/go.dbus/prop
github.com/gilbertchen/goamz/autoscaling
github.com/gilbertchen/goamz/aws
github.com/gilbertchen/goamz/cloudformation
github.com/gilbertchen/goamz/cloudfront
github.com/gilbertchen/goamz/cloudwatch
github.com/gilbertchen/goamz/dynamodb
github.com/gilbertchen/goamz/ec2
github.com/gilbertchen/goamz/ec2/ec2test
github.com/gilbertchen/goamz/ecs
github.com/gilbertchen/goamz/elb
github.com/gilbertchen/goamz/elb/elbtest
github.com/gilbertchen/goamz/exp/mturk
github.com/gilbertchen/goamz/exp/sdb
github.com/gilbertchen/goamz/exp/ses
github.com/gilbertchen/goamz/exp/sns
github.com/gilbertchen/goamz/iam
github.com/gilbertchen/goamz/iam/iamtest
github.com/gilbertchen/goamz/rds
github.com/gilbertchen/goamz/route53
github.com/gilbertchen/goamz/s3
github.com/gilbertchen/goamz/s3/s3test
github.com/gilbertchen/goamz/sqs
github.com/gilbertchen/goamz/sts
github.com/gilbertchen/goamz/testutil
github.com/gilbertchen/gopass
github.com/gilbertchen/keyring
github.com/gilbertchen/keyring/keyring-example
github.com/gilbertchen/xattr
github.com/gilbertchen/xattr/xattr-example
github.com/gizak/termui
github.com/gizak/termui/debug
github.com/gizak/termui/extra
github.com/gizak/termui/test
github.com/glycerine/go-capnproto
github.com/glycerine/go-capnproto/aircraftlib
github.com/glycerine/go-capnproto/capnpc-go
github.com/glycerine/rbtree
github.com/gnewton/chidley
github.com/go-chi/chi
github.com/go-chi/chi/middleware
github.com/go-errors/errors
github.com/go-forks/fsnotify
github.com/go-forks/go-pkg-xmlx
github.com/go-ini/ini
github.com/go-ole/go-ole
github.com/go-ole/go-ole/oleutil
github.com/go-redis/redis
github.com/go-redis/redis/internal
github.com/go-redis/redis/internal/consistenthash
github.com/go-redis/redis/internal/hashtag
github.com/go-redis/redis/internal/pool
github.com/go-redis/redis/internal/proto
github.com/go-siris/siris
github.com/go-siris/siris/cache
github.com/go-siris/siris/cache/cfg
github.com/go-siris/siris/cache/client
github.com/go-siris/siris/cache/client/rule
github.com/go-siris/siris/cache/entry
github.com/go-siris/siris/cache/ruleset
github.com/go-siris/siris/cache/uri
github.com/go-siris/siris/configuration
github.com/go-siris/siris/context
github.com/go-siris/siris/core/errors
github.com/go-siris/siris/core/handlerconv
github.com/go-siris/siris/core/host
github.com/go-siris/siris/core/memstore
github.com/go-siris/siris/core/nettools
github.com/go-siris/siris/core/router
github.com/go-siris/siris/core/router/macro
github.com/go-siris/siris/core/router/macro/interpreter/ast
github.com/go-siris/siris/core/router/macro/interpreter/lexer
github.com/go-siris/siris/core/router/macro/interpreter/parser
github.com/go-siris/siris/core/router/macro/interpreter/token
github.com/go-siris/siris/core/router/node
github.com/go-siris/siris/httptest
github.com/go-siris/siris/sessions
github.com/go-siris/siris/sessions/couchbase
github.com/go-siris/siris/sessions/ledis
github.com/go-siris/siris/sessions/memcache
github.com/go-siris/siris/sessions/mysql
github.com/go-siris/siris/sessions/postgres
github.com/go-siris/siris/sessions/redis
github.com/go-siris/siris/sessions/ssdb
github.com/go-siris/siris/typescript
github.com/go-siris/siris/typescript/editor
github.com/go-siris/siris/typescript/npm
github.com/go-siris/siris/view
github.com/go-siris/siris/websocket
github.com/go-sql-driver/mysql
github.com/go-vgo/robotgo
github.com/go-vgo/robotgo/clipboard
github.com/go-vgo/robotgo/clipboard/cmd/gocopy
github.com/go-vgo/robotgo/clipboard/cmd/gopaste
github.com/go-vgo/robotgo/examples
github.com/go-vgo/robotgo/examples/bitmap
github.com/go-vgo/robotgo/examples/event
github.com/go-vgo/robotgo/examples/key
github.com/go-vgo/robotgo/examples/mouse
github.com/go-vgo/robotgo/examples/screen
github.com/go-vgo/robotgo/examples/window
github.com/go-vgo/robotgo/test
github.com/go-xorm/builder
github.com/go-xorm/cmd/xorm
github.com/go-xorm/core
github.com/go-xorm/xorm
github.com/go-xorm/xorm/examples
github.com/go-xorm/xorm/migrate
github.com/go-yaml/yaml
github.com/gobuffalo/buffalo
github.com/gobuffalo/buffalo/binding
github.com/gobuffalo/buffalo/buffalo
github.com/gobuffalo/buffalo/buffalo/cmd
github.com/gobuffalo/buffalo/buffalo/cmd/build
github.com/gobuffalo/buffalo/buffalo/cmd/destroy
github.com/gobuffalo/buffalo/buffalo/cmd/generate
github.com/gobuffalo/buffalo/generators
github.com/gobuffalo/buffalo/generators/action
github.com/gobuffalo/buffalo/generators/assets
github.com/gobuffalo/buffalo/generators/assets/standard
github.com/gobuffalo/buffalo/generators/assets/webpack
github.com/gobuffalo/buffalo/generators/docker
github.com/gobuffalo/buffalo/generators/grift
github.com/gobuffalo/buffalo/generators/mail
github.com/gobuffalo/buffalo/generators/newapp
github.com/gobuffalo/buffalo/generators/refresh
github.com/gobuffalo/buffalo/generators/resource
github.com/gobuffalo/buffalo/generators/soda
github.com/gobuffalo/buffalo/grifts
github.com/gobuffalo/buffalo/mail
github.com/gobuffalo/buffalo/meta
github.com/gobuffalo/buffalo/middleware
github.com/gobuffalo/buffalo/middleware/basicauth
github.com/gobuffalo/buffalo/middleware/csrf
github.com/gobuffalo/buffalo/middleware/i18n
github.com/gobuffalo/buffalo/middleware/ssl
github.com/gobuffalo/buffalo/plugins
github.com/gobuffalo/buffalo/render
github.com/gobuffalo/buffalo/worker
github.com/gobuffalo/envy
github.com/gobuffalo/makr
github.com/gobuffalo/packr
github.com/gobuffalo/packr/builder
github.com/gobuffalo/packr/example
github.com/gobuffalo/packr/example/foo
github.com/gobuffalo/packr/grifts
github.com/gobuffalo/packr/packr
github.com/gobuffalo/packr/packr/cmd
github.com/gobuffalo/plush
github.com/gobuffalo/plush/ast
github.com/gobuffalo/plush/lexer
github.com/gobuffalo/plush/parser
github.com/gobuffalo/plush/plush
github.com/gobuffalo/plush/plush/cmd
github.com/gobuffalo/plush/token
github.com/gobuffalo/tags
github.com/gobuffalo/tags/form
github.com/gobuffalo/tags/form/bootstrap
github.com/gobuffalo/velvet
github.com/gobuffalo/x/fakesmtp
github.com/gobuffalo/x/httpx
github.com/gobuffalo/x/mail
github.com/gobuffalo/x/mail/buffalo-mail
github.com/gobuffalo/x/mail/buffalo-mail/cmd
github.com/gobuffalo/x/responder
github.com/gobuffalo/x/sessions
github.com/gobwas/glob
github.com/gobwas/glob/cmd/globdraw
github.com/gobwas/glob/cmd/globtest
github.com/gobwas/glob/compiler
github.com/gobwas/glob/match
github.com/gobwas/glob/match/debug
github.com/gobwas/glob/syntax
github.com/gobwas/glob/syntax/ast
github.com/gobwas/glob/syntax/lexer
github.com/gobwas/glob/util/runes
github.com/gobwas/glob/util/strings
github.com/godbus/dbus
github.com/godbus/dbus/introspect
github.com/godbus/dbus/prop
github.com/godoctor/godoctor
github.com/godoctor/godoctor/analysis/cfg
github.com/godoctor/godoctor/analysis/dataflow
github.com/godoctor/godoctor/analysis/names
github.com/godoctor/godoctor/doc
github.com/godoctor/godoctor/engine
github.com/godoctor/godoctor/engine/cli
github.com/godoctor/godoctor/engine/protocol
github.com/godoctor/godoctor/filesystem
github.com/godoctor/godoctor/refactoring
github.com/godoctor/godoctor/refactoring/testutil
github.com/godoctor/godoctor/text
github.com/gogits/gogs
github.com/gogits/gogs/cmd
github.com/gogits/gogs/docker/armhf
github.com/gogits/gogs/models
github.com/gogits/gogs/models/errors
github.com/gogits/gogs/models/migrations
github.com/gogits/gogs/pkg/auth
github.com/gogits/gogs/pkg/auth/ldap
github.com/gogits/gogs/pkg/auth/pam
github.com/gogits/gogs/pkg/avatar
github.com/gogits/gogs/pkg/bindata
github.com/gogits/gogs/pkg/context
github.com/gogits/gogs/pkg/cron
github.com/gogits/gogs/pkg/form
github.com/gogits/gogs/pkg/httplib
github.com/gogits/gogs/pkg/mailer
github.com/gogits/gogs/pkg/markup
github.com/gogits/gogs/pkg/process
github.com/gogits/gogs/pkg/setting
github.com/gogits/gogs/pkg/ssh
github.com/gogits/gogs/pkg/sync
github.com/gogits/gogs/pkg/template
github.com/gogits/gogs/pkg/template/highlight
github.com/gogits/gogs/pkg/tool
github.com/gogits/gogs/pkg/user
github.com/gogits/gogs/routes
github.com/gogits/gogs/routes/admin
github.com/gogits/gogs/routes/api/v1
github.com/gogits/gogs/routes/api/v1/admin
github.com/gogits/gogs/routes/api/v1/convert
github.com/gogits/gogs/routes/api/v1/misc
github.com/gogits/gogs/routes/api/v1/org
github.com/gogits/gogs/routes/api/v1/repo
github.com/gogits/gogs/routes/api/v1/user
github.com/gogits/gogs/routes/dev
github.com/gogits/gogs/routes/org
github.com/gogits/gogs/routes/repo
github.com/gogits/gogs/routes/user
github.com/gogo/protobuf/codec
github.com/gogo/protobuf/gogoproto
github.com/gogo/protobuf/gogoreplace
github.com/gogo/protobuf/io
github.com/gogo/protobuf/jsonpb
github.com/gogo/protobuf/jsonpb/jsonpb_test_proto
github.com/gogo/protobuf/plugin/compare
github.com/gogo/protobuf/plugin/defaultcheck
github.com/gogo/protobuf/plugin/description
github.com/gogo/protobuf/plugin/embedcheck
github.com/gogo/protobuf/plugin/enumstringer
github.com/gogo/protobuf/plugin/equal
github.com/gogo/protobuf/plugin/face
github.com/gogo/protobuf/plugin/gostring
github.com/gogo/protobuf/plugin/marshalto
github.com/gogo/protobuf/plugin/oneofcheck
github.com/gogo/protobuf/plugin/populate
github.com/gogo/protobuf/plugin/size
github.com/gogo/protobuf/plugin/stringer
github.com/gogo/protobuf/plugin/testgen
github.com/gogo/protobuf/plugin/union
github.com/gogo/protobuf/plugin/unmarshal
github.com/gogo/protobuf/proto
github.com/gogo/protobuf/proto/proto3_proto
github.com/gogo/protobuf/protoc-gen-combo
github.com/gogo/protobuf/protoc-gen-gofast
github.com/gogo/protobuf/protoc-gen-gogo
github.com/gogo/protobuf/protoc-gen-gogo/descriptor
github.com/gogo/protobuf/protoc-gen-gogo/generator
github.com/gogo/protobuf/protoc-gen-gogo/grpc
github.com/gogo/protobuf/protoc-gen-gogo/plugin
github.com/gogo/protobuf/protoc-gen-gogofast
github.com/gogo/protobuf/protoc-gen-gogofaster
github.com/gogo/protobuf/protoc-gen-gogoslick
github.com/gogo/protobuf/protoc-gen-gogotypes
github.com/gogo/protobuf/protoc-gen-gostring
github.com/gogo/protobuf/protoc-min-version
github.com/gogo/protobuf/sortkeys
github.com/gogo/protobuf/test
github.com/gogo/protobuf/test/asymetric-issue125
github.com/gogo/protobuf/test/casttype
github.com/gogo/protobuf/test/casttype/combos/both
github.com/gogo/protobuf/test/casttype/combos/marshaler
github.com/gogo/protobuf/test/casttype/combos/neither
github.com/gogo/protobuf/test/casttype/combos/unmarshaler
github.com/gogo/protobuf/test/castvalue
github.com/gogo/protobuf/test/castvalue/combos/both
github.com/gogo/protobuf/test/castvalue/combos/marshaler
github.com/gogo/protobuf/test/castvalue/combos/unmarshaler
github.com/gogo/protobuf/test/combos/both
github.com/gogo/protobuf/test/combos/marshaler
github.com/gogo/protobuf/test/combos/unmarshaler
github.com/gogo/protobuf/test/custom
github.com/gogo/protobuf/test/custom-dash-type
github.com/gogo/protobuf/test/custombytesnonstruct
github.com/gogo/protobuf/test/dashfilename
github.com/gogo/protobuf/test/data
github.com/gogo/protobuf/test/defaultconflict
github.com/gogo/protobuf/test/embedconflict
github.com/gogo/protobuf/test/empty-issue70
github.com/gogo/protobuf/test/enumcustomname
github.com/gogo/protobuf/test/enumdecl
github.com/gogo/protobuf/test/enumdecl_all
github.com/gogo/protobuf/test/enumprefix
github.com/gogo/protobuf/test/enumstringer
github.com/gogo/protobuf/test/example
github.com/gogo/protobuf/test/filedotname
github.com/gogo/protobuf/test/fuzztests
github.com/gogo/protobuf/test/group
github.com/gogo/protobuf/test/importdedup
github.com/gogo/protobuf/test/importdedup/subpkg
github.com/gogo/protobuf/test/importduplicate
github.com/gogo/protobuf/test/importduplicate/proto
github.com/gogo/protobuf/test/importduplicate/sortkeys
github.com/gogo/protobuf/test/indeximport-issue72
github.com/gogo/protobuf/test/indeximport-issue72/index
github.com/gogo/protobuf/test/int64support
github.com/gogo/protobuf/test/issue260
github.com/gogo/protobuf/test/issue261
github.com/gogo/protobuf/test/issue262
github.com/gogo/protobuf/test/issue270
github.com/gogo/protobuf/test/issue312
github.com/gogo/protobuf/test/issue312/events
github.com/gogo/protobuf/test/issue322
github.com/gogo/protobuf/test/issue330
github.com/gogo/protobuf/test/issue34
github.com/gogo/protobuf/test/issue42order
github.com/gogo/protobuf/test/issue8
github.com/gogo/protobuf/test/jsonpb-gogo
github.com/gogo/protobuf/test/mapdefaults
github.com/gogo/protobuf/test/mapdefaults/combos/both
github.com/gogo/protobuf/test/mapdefaults/combos/marshaler
github.com/gogo/protobuf/test/mapdefaults/combos/neither
github.com/gogo/protobuf/test/mapdefaults/combos/unmarshaler
github.com/gogo/protobuf/test/mapsproto2
github.com/gogo/protobuf/test/mapsproto2/combos/both
github.com/gogo/protobuf/test/mapsproto2/combos/marshaler
github.com/gogo/protobuf/test/mapsproto2/combos/neither
github.com/gogo/protobuf/test/mapsproto2/combos/unmarshaler
github.com/gogo/protobuf/test/mixbench
github.com/gogo/protobuf/test/moredefaults
github.com/gogo/protobuf/test/nopackage
github.com/gogo/protobuf/test/oneof
github.com/gogo/protobuf/test/oneof/combos/both
github.com/gogo/protobuf/test/oneof/combos/marshaler
github.com/gogo/protobuf/test/oneof/combos/neither
github.com/gogo/protobuf/test/oneof/combos/unmarshaler
github.com/gogo/protobuf/test/oneof3
github.com/gogo/protobuf/test/oneof3/combos/both
github.com/gogo/protobuf/test/oneof3/combos/marshaler
github.com/gogo/protobuf/test/oneof3/combos/neither
github.com/gogo/protobuf/test/oneof3/combos/unmarshaler
github.com/gogo/protobuf/test/oneofembed
github.com/gogo/protobuf/test/packed
github.com/gogo/protobuf/test/proto3extension
github.com/gogo/protobuf/test/protosize
github.com/gogo/protobuf/test/required
github.com/gogo/protobuf/test/sizerconflict
github.com/gogo/protobuf/test/sizeunderscore
github.com/gogo/protobuf/test/stdtypes
github.com/gogo/protobuf/test/tags
github.com/gogo/protobuf/test/theproto3
github.com/gogo/protobuf/test/theproto3/combos/both
github.com/gogo/protobuf/test/theproto3/combos/marshaler
github.com/gogo/protobuf/test/theproto3/combos/neither
github.com/gogo/protobuf/test/theproto3/combos/unmarshaler
github.com/gogo/protobuf/test/typedecl
github.com/gogo/protobuf/test/typedecl_all
github.com/gogo/protobuf/test/typedeclimport
github.com/gogo/protobuf/test/typedeclimport/subpkg
github.com/gogo/protobuf/test/types/combos/both
github.com/gogo/protobuf/test/types/combos/marshaler
github.com/gogo/protobuf/test/types/combos/neither
github.com/gogo/protobuf/test/types/combos/unmarshaler
github.com/gogo/protobuf/test/unmarshalmerge
github.com/gogo/protobuf/test/unrecognized
github.com/gogo/protobuf/test/unrecognizedgroup
github.com/gogo/protobuf/types
github.com/gogo/protobuf/vanity
github.com/gogo/protobuf/vanity/command
github.com/gogo/protobuf/vanity/test
github.com/gogo/protobuf/vanity/test/fast
github.com/gogo/protobuf/vanity/test/faster
github.com/gogo/protobuf/vanity/test/slick
github.com/gogo/protobuf/version
github.com/gohugoio/hugo
github.com/gohugoio/hugo/bufferpool
github.com/gohugoio/hugo/cache
github.com/gohugoio/hugo/commands
github.com/gohugoio/hugo/common/types
github.com/gohugoio/hugo/compare
github.com/gohugoio/hugo/config
github.com/gohugoio/hugo/create
github.com/gohugoio/hugo/deps
github.com/gohugoio/hugo/docshelper
github.com/gohugoio/hugo/helpers
github.com/gohugoio/hugo/hugofs
github.com/gohugoio/hugo/hugolib
github.com/gohugoio/hugo/i18n
github.com/gohugoio/hugo/livereload
github.com/gohugoio/hugo/media
github.com/gohugoio/hugo/metrics
github.com/gohugoio/hugo/output
github.com/gohugoio/hugo/parser
github.com/gohugoio/hugo/related
github.com/gohugoio/hugo/releaser
github.com/gohugoio/hugo/resource
github.com/gohugoio/hugo/source
github.com/gohugoio/hugo/tpl
github.com/gohugoio/hugo/tpl/cast
github.com/gohugoio/hugo/tpl/collections
github.com/gohugoio/hugo/tpl/compare
github.com/gohugoio/hugo/tpl/crypto
github.com/gohugoio/hugo/tpl/data
github.com/gohugoio/hugo/tpl/encoding
github.com/gohugoio/hugo/tpl/fmt
github.com/gohugoio/hugo/tpl/images
github.com/gohugoio/hugo/tpl/inflect
github.com/gohugoio/hugo/tpl/internal
github.com/gohugoio/hugo/tpl/lang
github.com/gohugoio/hugo/tpl/math
github.com/gohugoio/hugo/tpl/os
github.com/gohugoio/hugo/tpl/partials
github.com/gohugoio/hugo/tpl/safe
github.com/gohugoio/hugo/tpl/strings
github.com/gohugoio/hugo/tpl/time
github.com/gohugoio/hugo/tpl/tplimpl
github.com/gohugoio/hugo/tpl/transform
github.com/gohugoio/hugo/tpl/urls
github.com/gohugoio/hugo/transform
github.com/gohugoio/hugo/utils
github.com/gohugoio/hugo/watcher
github.com/gohxs/readline
github.com/gohxs/readline/example/readline-demo
github.com/gohxs/readline/example/readline-im
github.com/gohxs/readline/example/readline-multiline
github.com/gohxs/readline/example/readline-pass-strength
github.com/gohxs/readline/example/readline-remote/readline-remote-client
github.com/gohxs/readline/example/readline-remote/readline-remote-server
github.com/gohxs/readline/runes
github.com/golang/dep
github.com/golang/dep/cmd/dep
github.com/golang/dep/gps
github.com/golang/dep/gps/internal/pb
github.com/golang/dep/gps/paths
github.com/golang/dep/gps/pkgtree
github.com/golang/dep/hack/licenseok
github.com/golang/dep/internal/feedback
github.com/golang/dep/internal/fs
github.com/golang/dep/internal/importers
github.com/golang/dep/internal/importers/base
github.com/golang/dep/internal/importers/glide
github.com/golang/dep/internal/importers/glock
github.com/golang/dep/internal/importers/godep
github.com/golang/dep/internal/importers/govend
github.com/golang/dep/internal/importers/govendor
github.com/golang/dep/internal/importers/gvt
github.com/golang/dep/internal/importers/importertest
github.com/golang/dep/internal/importers/vndr
github.com/golang/dep/internal/test
github.com/golang/dep/internal/test/integration
github.com/golang/freetype
github.com/golang/freetype/raster
github.com/golang/freetype/truetype
github.com/golang/glog
github.com/golang/lint
github.com/golang/lint/golint
github.com/golang/protobuf/descriptor
github.com/golang/protobuf/jsonpb
github.com/golang/protobuf/jsonpb/jsonpb_test_proto
github.com/golang/protobuf/proto
github.com/golang/protobuf/proto/proto3_proto
github.com/golang/protobuf/protoc-gen-go
github.com/golang/protobuf/protoc-gen-go/descriptor
github.com/golang/protobuf/protoc-gen-go/generator
github.com/golang/protobuf/protoc-gen-go/grpc
github.com/golang/protobuf/protoc-gen-go/plugin
github.com/golang/protobuf/ptypes
github.com/golang/protobuf/ptypes/any
github.com/golang/protobuf/ptypes/duration
github.com/golang/protobuf/ptypes/empty
github.com/golang/protobuf/ptypes/struct
github.com/golang/protobuf/ptypes/timestamp
github.com/golang/protobuf/ptypes/wrappers
github.com/golang/snappy
github.com/google/btree
github.com/google/flatbuffers/go
github.com/google/flatbuffers/grpc/tests
github.com/google/flatbuffers/samples
github.com/google/flatbuffers/tests
github.com/google/flatbuffers/tests/MyGame
github.com/google/flatbuffers/tests/MyGame/Example
github.com/google/flatbuffers/tests/MyGame/Example2
github.com/google/flatbuffers/tests/namespace_test/NamespaceA
github.com/google/flatbuffers/tests/namespace_test/NamespaceA/NamespaceB
github.com/google/flatbuffers/tests/namespace_test/NamespaceC
github.com/google/go-genproto/googleapis/api
github.com/google/go-genproto/googleapis/api/annotations
github.com/google/go-genproto/googleapis/api/configchange
github.com/google/go-genproto/googleapis/api/distribution
github.com/google/go-genproto/googleapis/api/httpbody
github.com/google/go-genproto/googleapis/api/label
github.com/google/go-genproto/googleapis/api/metric
github.com/google/go-genproto/googleapis/api/monitoredres
github.com/google/go-genproto/googleapis/api/serviceconfig
github.com/google/go-genproto/googleapis/api/servicecontrol/v1
github.com/google/go-genproto/googleapis/api/servicemanagement/v1
github.com/google/go-genproto/googleapis/appengine/legacy
github.com/google/go-genproto/googleapis/appengine/logging/v1
github.com/google/go-genproto/googleapis/appengine/v1
github.com/google/go-genproto/googleapis/assistant/embedded/v1alpha1
github.com/google/go-genproto/googleapis/assistant/embedded/v1alpha2
github.com/google/go-genproto/googleapis/bigtable/admin/cluster/v1
github.com/google/go-genproto/googleapis/bigtable/admin/table/v1
github.com/google/go-genproto/googleapis/bigtable/admin/v2
github.com/google/go-genproto/googleapis/bigtable/v1
github.com/google/go-genproto/googleapis/bigtable/v2
github.com/google/go-genproto/googleapis/bytestream
github.com/google/go-genproto/googleapis/cloud/audit
github.com/google/go-genproto/googleapis/cloud/bigquery/datatransfer/v1
github.com/google/go-genproto/googleapis/cloud/bigquery/logging/v1
github.com/google/go-genproto/googleapis/cloud/billing/v1
github.com/google/go-genproto/googleapis/cloud/dataproc/v1
github.com/google/go-genproto/googleapis/cloud/dataproc/v1beta2
github.com/google/go-genproto/googleapis/cloud/functions/v1beta2
github.com/google/go-genproto/googleapis/cloud/iot/v1
github.com/google/go-genproto/googleapis/cloud/language/v1
github.com/google/go-genproto/googleapis/cloud/language/v1beta1
github.com/google/go-genproto/googleapis/cloud/language/v1beta2
github.com/google/go-genproto/googleapis/cloud/location
github.com/google/go-genproto/googleapis/cloud/ml/v1
github.com/google/go-genproto/googleapis/cloud/ml/v1beta1
github.com/google/go-genproto/googleapis/cloud/oslogin/common
github.com/google/go-genproto/googleapis/cloud/oslogin/v1alpha
github.com/google/go-genproto/googleapis/cloud/oslogin/v1beta
github.com/google/go-genproto/googleapis/cloud/resourcemanager/v2
github.com/google/go-genproto/googleapis/cloud/runtimeconfig/v1beta1
github.com/google/go-genproto/googleapis/cloud/speech/v1
github.com/google/go-genproto/googleapis/cloud/speech/v1beta1
github.com/google/go-genproto/googleapis/cloud/speech/v1p1beta1
github.com/google/go-genproto/googleapis/cloud/support/common
github.com/google/go-genproto/googleapis/cloud/support/v1alpha1
github.com/google/go-genproto/googleapis/cloud/videointelligence/v1
github.com/google/go-genproto/googleapis/cloud/videointelligence/v1beta1
github.com/google/go-genproto/googleapis/cloud/videointelligence/v1beta2
github.com/google/go-genproto/googleapis/cloud/vision/v1
github.com/google/go-genproto/googleapis/cloud/vision/v1p1beta1
github.com/google/go-genproto/googleapis/container/v1
github.com/google/go-genproto/googleapis/container/v1alpha1
github.com/google/go-genproto/googleapis/container/v1beta1
github.com/google/go-genproto/googleapis/datastore/admin/v1beta1
github.com/google/go-genproto/googleapis/datastore/v1
github.com/google/go-genproto/googleapis/datastore/v1beta3
github.com/google/go-genproto/googleapis/devtools/build/v1
github.com/google/go-genproto/googleapis/devtools/cloudbuild/v1
github.com/google/go-genproto/googleapis/devtools/clouddebugger/v2
github.com/google/go-genproto/googleapis/devtools/clouderrorreporting/v1beta1
github.com/google/go-genproto/googleapis/devtools/cloudprofiler/v2
github.com/google/go-genproto/googleapis/devtools/cloudtrace/v1
github.com/google/go-genproto/googleapis/devtools/cloudtrace/v2
github.com/google/go-genproto/googleapis/devtools/containeranalysis/v1alpha1
github.com/google/go-genproto/googleapis/devtools/remoteexecution/v1test
github.com/google/go-genproto/googleapis/devtools/source/v1
github.com/google/go-genproto/googleapis/devtools/sourcerepo/v1
github.com/google/go-genproto/googleapis/example/library/v1
github.com/google/go-genproto/googleapis/firestore/admin/v1beta1
github.com/google/go-genproto/googleapis/firestore/v1beta1
github.com/google/go-genproto/googleapis/genomics/v1
github.com/google/go-genproto/googleapis/genomics/v1alpha2
github.com/google/go-genproto/googleapis/iam/admin/v1
github.com/google/go-genproto/googleapis/iam/v1
github.com/google/go-genproto/googleapis/iam/v1/logging
github.com/google/go-genproto/googleapis/logging/type
github.com/google/go-genproto/googleapis/logging/v2
github.com/google/go-genproto/googleapis/longrunning
github.com/google/go-genproto/googleapis/monitoring/v3
github.com/google/go-genproto/googleapis/privacy/dlp/v2beta1
github.com/google/go-genproto/googleapis/pubsub/v1
github.com/google/go-genproto/googleapis/pubsub/v1beta2
github.com/google/go-genproto/googleapis/rpc/code
github.com/google/go-genproto/googleapis/rpc/errdetails
github.com/google/go-genproto/googleapis/rpc/status
github.com/google/go-genproto/googleapis/spanner/admin/database/v1
github.com/google/go-genproto/googleapis/spanner/admin/instance/v1
github.com/google/go-genproto/googleapis/spanner/v1
github.com/google/go-genproto/googleapis/storagetransfer/v1
github.com/google/go-genproto/googleapis/streetview/publish/v1
github.com/google/go-genproto/googleapis/tracing/v1
github.com/google/go-genproto/googleapis/type/color
github.com/google/go-genproto/googleapis/type/date
github.com/google/go-genproto/googleapis/type/dayofweek
github.com/google/go-genproto/googleapis/type/latlng
github.com/google/go-genproto/googleapis/type/money
github.com/google/go-genproto/googleapis/type/postaladdress
github.com/google/go-genproto/googleapis/type/timeofday
github.com/google/go-genproto/googleapis/watcher/v1
github.com/google/go-genproto/protobuf/api
github.com/google/go-genproto/protobuf/field_mask
github.com/google/go-genproto/protobuf/ptype
github.com/google/go-genproto/protobuf/source_context
github.com/google/go-github/example/appengine
github.com/google/go-github/example/basicauth
github.com/google/go-github/github
github.com/google/go-github/test/fields
github.com/google/go-github/test/integration
github.com/google/go-querystring/query
github.com/google/gopacket
github.com/google/gopacket/afpacket
github.com/google/gopacket/bytediff
github.com/google/gopacket/dumpcommand
github.com/google/gopacket/examples/arpscan
github.com/google/gopacket/examples/bidirectional
github.com/google/gopacket/examples/bytediff
github.com/google/gopacket/examples/httpassembly
github.com/google/gopacket/examples/pcapdump
github.com/google/gopacket/examples/pcaplay
github.com/google/gopacket/examples/pfdump
github.com/google/gopacket/examples/reassemblydump
github.com/google/gopacket/examples/statsassembly
github.com/google/gopacket/examples/synscan
github.com/google/gopacket/examples/util
github.com/google/gopacket/ip4defrag
github.com/google/gopacket/layers
github.com/google/gopacket/macs
github.com/google/gopacket/pcap
github.com/google/gopacket/pcap/gopacket_benchmark
github.com/google/gopacket/pcapgo
github.com/google/gopacket/pfring
github.com/google/gopacket/reassembly
github.com/google/gopacket/routing
github.com/google/gopacket/tcpassembly
github.com/google/gopacket/tcpassembly/tcpreader
github.com/google/grumpy/runtime
github.com/google/grumpy/tools
github.com/google/shlex
github.com/google/subcommands
github.com/googleapis/gax-go
github.com/gopherjs/gopherjs
github.com/gopherjs/gopherjs/build
github.com/gopherjs/gopherjs/compiler
github.com/gopherjs/gopherjs/compiler/analysis
github.com/gopherjs/gopherjs/compiler/astutil
github.com/gopherjs/gopherjs/compiler/filter
github.com/gopherjs/gopherjs/compiler/natives
github.com/gopherjs/gopherjs/compiler/prelude
github.com/gopherjs/gopherjs/compiler/typesutil
github.com/gopherjs/gopherjs/internal/sysutil
github.com/gopherjs/gopherjs/js
github.com/gopherjs/gopherjs/nosync
github.com/gopherjs/gopherjs/tests
github.com/gopherjs/gopherjs/tests/main
github.com/gopherjs/gopherjs/tests/otherpkg
github.com/gopherjs/vecty
github.com/gopherjs/vecty/elem
github.com/gopherjs/vecty/event
github.com/gopherjs/vecty/example/markdown
github.com/gopherjs/vecty/example/todomvc
github.com/gopherjs/vecty/example/todomvc/actions
github.com/gopherjs/vecty/example/todomvc/components
github.com/gopherjs/vecty/example/todomvc/dispatcher
github.com/gopherjs/vecty/example/todomvc/store
github.com/gopherjs/vecty/example/todomvc/store/model
github.com/gopherjs/vecty/example/todomvc/store/storeutil
github.com/gopherjs/vecty/prop
github.com/gopherjs/vecty/style
github.com/goreleaser/archive
github.com/goreleaser/archive/tar
github.com/goreleaser/archive/zip
github.com/goreleaser/goreleaser
github.com/goreleaser/goreleaser/checksum
github.com/goreleaser/goreleaser/config
github.com/goreleaser/goreleaser/context
github.com/goreleaser/goreleaser/goreleaserlib
github.com/goreleaser/goreleaser/internal/artifact
github.com/goreleaser/goreleaser/internal/buildtarget
github.com/goreleaser/goreleaser/internal/client
github.com/goreleaser/goreleaser/internal/ext
github.com/goreleaser/goreleaser/internal/filenametemplate
github.com/goreleaser/goreleaser/internal/git
github.com/goreleaser/goreleaser/internal/linux
github.com/goreleaser/goreleaser/internal/testlib
github.com/goreleaser/goreleaser/pipeline
github.com/goreleaser/goreleaser/pipeline/archive
github.com/goreleaser/goreleaser/pipeline/artifactory
github.com/goreleaser/goreleaser/pipeline/brew
github.com/goreleaser/goreleaser/pipeline/build
github.com/goreleaser/goreleaser/pipeline/changelog
github.com/goreleaser/goreleaser/pipeline/checksums
github.com/goreleaser/goreleaser/pipeline/defaults
github.com/goreleaser/goreleaser/pipeline/dist
github.com/goreleaser/goreleaser/pipeline/docker
github.com/goreleaser/goreleaser/pipeline/effectiveconfig
github.com/goreleaser/goreleaser/pipeline/env
github.com/goreleaser/goreleaser/pipeline/fpm
github.com/goreleaser/goreleaser/pipeline/git
github.com/goreleaser/goreleaser/pipeline/release
github.com/goreleaser/goreleaser/pipeline/sign
github.com/goreleaser/goreleaser/pipeline/snapcraft
github.com/goreleaser/goreleaser/pipeline/snapshot
github.com/gorilla/context
github.com/gorilla/mux
github.com/gorilla/schema
github.com/gorilla/securecookie
github.com/gorilla/securecookie/fuzz
github.com/gorilla/sessions
github.com/gorilla/websocket
github.com/gorilla/websocket/examples/autobahn
github.com/gorilla/websocket/examples/chat
github.com/gorilla/websocket/examples/command
github.com/gorilla/websocket/examples/filewatch
github.com/gosuri/uitable
github.com/gosuri/uitable/example
github.com/gosuri/uitable/util/strutil
github.com/gosuri/uitable/util/wordwrap
github.com/gregjones/httpcache
github.com/gregjones/httpcache/diskcache
github.com/gregjones/httpcache/leveldbcache
github.com/gregjones/httpcache/memcache
github.com/gregjones/httpcache/redis
github.com/hailocab/go-hostpool
github.com/hashicorp/go-cleanhttp
github.com/hashicorp/go-immutable-radix
github.com/hashicorp/go-multierror
github.com/hashicorp/go-syslog
github.com/hashicorp/go-uuid
github.com/hashicorp/golang-lru
github.com/hashicorp/golang-lru/simplelru
github.com/hashicorp/hcl
github.com/hashicorp/hcl/hcl/ast
github.com/hashicorp/hcl/hcl/fmtcmd
github.com/hashicorp/hcl/hcl/parser
github.com/hashicorp/hcl/hcl/printer
github.com/hashicorp/hcl/hcl/scanner
github.com/hashicorp/hcl/hcl/strconv
github.com/hashicorp/hcl/hcl/token
github.com/hashicorp/hcl/json/parser
github.com/hashicorp/hcl/json/scanner
github.com/hashicorp/hcl/json/token
github.com/hashicorp/hcl/testhelper
github.com/hashicorp/nomad
github.com/hashicorp/nomad/acl
github.com/hashicorp/nomad/api
github.com/hashicorp/nomad/api/contexts
github.com/hashicorp/nomad/client
github.com/hashicorp/nomad/client/allocdir
github.com/hashicorp/nomad/client/config
github.com/hashicorp/nomad/client/driver
github.com/hashicorp/nomad/client/driver/env
github.com/hashicorp/nomad/client/driver/executor
github.com/hashicorp/nomad/client/driver/logging
github.com/hashicorp/nomad/client/driver/structs
github.com/hashicorp/nomad/client/fingerprint
github.com/hashicorp/nomad/client/getter
github.com/hashicorp/nomad/client/stats
github.com/hashicorp/nomad/client/structs
github.com/hashicorp/nomad/client/testutil
github.com/hashicorp/nomad/client/vaultclient
github.com/hashicorp/nomad/command
github.com/hashicorp/nomad/command/agent
github.com/hashicorp/nomad/command/agent/consul
github.com/hashicorp/nomad/demo/digitalocean/app
github.com/hashicorp/nomad/e2e/migrations
github.com/hashicorp/nomad/helper
github.com/hashicorp/nomad/helper/args
github.com/hashicorp/nomad/helper/discover
github.com/hashicorp/nomad/helper/fields
github.com/hashicorp/nomad/helper/flag-helpers
github.com/hashicorp/nomad/helper/flatmap
github.com/hashicorp/nomad/helper/gated-writer
github.com/hashicorp/nomad/helper/stats
github.com/hashicorp/nomad/helper/testlog
github.com/hashicorp/nomad/helper/testtask
github.com/hashicorp/nomad/helper/tlsutil
github.com/hashicorp/nomad/helper/uuid
github.com/hashicorp/nomad/jobspec
github.com/hashicorp/nomad/nomad
github.com/hashicorp/nomad/nomad/deploymentwatcher
github.com/hashicorp/nomad/nomad/mock
github.com/hashicorp/nomad/nomad/state
github.com/hashicorp/nomad/nomad/structs
github.com/hashicorp/nomad/nomad/structs/config
github.com/hashicorp/nomad/nomad/types
github.com/hashicorp/nomad/scheduler
github.com/hashicorp/nomad/testutil
github.com/hashicorp/nomad/version
github.com/hashicorp/packer
github.com/hashicorp/packer/builder/alicloud/ecs
github.com/hashicorp/packer/builder/amazon/chroot
github.com/hashicorp/packer/builder/amazon/common
github.com/hashicorp/packer/builder/amazon/ebs
github.com/hashicorp/packer/builder/amazon/ebssurrogate
github.com/hashicorp/packer/builder/amazon/ebsvolume
github.com/hashicorp/packer/builder/amazon/instance
github.com/hashicorp/packer/builder/azure/arm
github.com/hashicorp/packer/builder/azure/common
github.com/hashicorp/packer/builder/azure/common/constants
github.com/hashicorp/packer/builder/azure/common/lin
github.com/hashicorp/packer/builder/azure/common/logutil
github.com/hashicorp/packer/builder/azure/common/template
github.com/hashicorp/packer/builder/azure/pkcs12
github.com/hashicorp/packer/builder/azure/pkcs12/rc2
github.com/hashicorp/packer/builder/cloudstack
github.com/hashicorp/packer/builder/digitalocean
github.com/hashicorp/packer/builder/docker
github.com/hashicorp/packer/builder/file
github.com/hashicorp/packer/builder/googlecompute
github.com/hashicorp/packer/builder/hyperv/common
github.com/hashicorp/packer/builder/hyperv/iso
github.com/hashicorp/packer/builder/hyperv/vmcx
github.com/hashicorp/packer/builder/lxc
github.com/hashicorp/packer/builder/lxd
github.com/hashicorp/packer/builder/null
github.com/hashicorp/packer/builder/oneandone
github.com/hashicorp/packer/builder/openstack
github.com/hashicorp/packer/builder/oracle/oci
github.com/hashicorp/packer/builder/oracle/oci/client
github.com/hashicorp/packer/builder/parallels/common
github.com/hashicorp/packer/builder/parallels/iso
github.com/hashicorp/packer/builder/parallels/pvm
github.com/hashicorp/packer/builder/profitbricks
github.com/hashicorp/packer/builder/qemu
github.com/hashicorp/packer/builder/triton
github.com/hashicorp/packer/builder/virtualbox/common
github.com/hashicorp/packer/builder/virtualbox/iso
github.com/hashicorp/packer/builder/virtualbox/ovf
github.com/hashicorp/packer/builder/vmware/common
github.com/hashicorp/packer/builder/vmware/iso
github.com/hashicorp/packer/builder/vmware/vmx
github.com/hashicorp/packer/command
github.com/hashicorp/packer/common
github.com/hashicorp/packer/common/json
github.com/hashicorp/packer/common/powershell
github.com/hashicorp/packer/common/powershell/hyperv
github.com/hashicorp/packer/common/ssh
github.com/hashicorp/packer/common/uuid
github.com/hashicorp/packer/communicator/none
github.com/hashicorp/packer/communicator/ssh
github.com/hashicorp/packer/communicator/winrm
github.com/hashicorp/packer/fix
github.com/hashicorp/packer/helper/builder/testing
github.com/hashicorp/packer/helper/communicator
github.com/hashicorp/packer/helper/config
github.com/hashicorp/packer/helper/enumflag
github.com/hashicorp/packer/helper/flag-kv
github.com/hashicorp/packer/helper/flag-slice
github.com/hashicorp/packer/packer
github.com/hashicorp/packer/packer/plugin
github.com/hashicorp/packer/packer/rpc
github.com/hashicorp/packer/plugin/example
github.com/hashicorp/packer/post-processor/alicloud-import
github.com/hashicorp/packer/post-processor/amazon-import
github.com/hashicorp/packer/post-processor/artifice
github.com/hashicorp/packer/post-processor/atlas
github.com/hashicorp/packer/post-processor/checksum
github.com/hashicorp/packer/post-processor/compress
github.com/hashicorp/packer/post-processor/docker-import
github.com/hashicorp/packer/post-processor/docker-push
github.com/hashicorp/packer/post-processor/docker-save
github.com/hashicorp/packer/post-processor/docker-tag
github.com/hashicorp/packer/post-processor/googlecompute-export
github.com/hashicorp/packer/post-processor/manifest
github.com/hashicorp/packer/post-processor/shell-local
github.com/hashicorp/packer/post-processor/vagrant
github.com/hashicorp/packer/post-processor/vagrant-cloud
github.com/hashicorp/packer/post-processor/vsphere
github.com/hashicorp/packer/post-processor/vsphere-template
github.com/hashicorp/packer/provisioner
github.com/hashicorp/packer/provisioner/ansible
github.com/hashicorp/packer/provisioner/ansible-local
github.com/hashicorp/packer/provisioner/chef-client
github.com/hashicorp/packer/provisioner/chef-solo
github.com/hashicorp/packer/provisioner/converge
github.com/hashicorp/packer/provisioner/file
github.com/hashicorp/packer/provisioner/powershell
github.com/hashicorp/packer/provisioner/puppet-masterless
github.com/hashicorp/packer/provisioner/puppet-server
github.com/hashicorp/packer/provisioner/salt-masterless
github.com/hashicorp/packer/provisioner/shell
github.com/hashicorp/packer/provisioner/shell-local
github.com/hashicorp/packer/provisioner/windows-restart
github.com/hashicorp/packer/provisioner/windows-shell
github.com/hashicorp/packer/scripts
github.com/hashicorp/packer/template
github.com/hashicorp/packer/template/interpolate
github.com/hashicorp/packer/version
github.com/hashicorp/terraform
github.com/hashicorp/terraform/backend
github.com/hashicorp/terraform/backend/atlas
github.com/hashicorp/terraform/backend/init
github.com/hashicorp/terraform/backend/legacy
github.com/hashicorp/terraform/backend/local
github.com/hashicorp/terraform/backend/remote-state
github.com/hashicorp/terraform/backend/remote-state/azure
github.com/hashicorp/terraform/backend/remote-state/consul
github.com/hashicorp/terraform/backend/remote-state/etcdv3
github.com/hashicorp/terraform/backend/remote-state/gcs
github.com/hashicorp/terraform/backend/remote-state/inmem
github.com/hashicorp/terraform/backend/remote-state/manta
github.com/hashicorp/terraform/backend/remote-state/s3
github.com/hashicorp/terraform/backend/remote-state/swift
github.com/hashicorp/terraform/builtin/bins/provider-test
github.com/hashicorp/terraform/builtin/bins/provisioner-chef
github.com/hashicorp/terraform/builtin/bins/provisioner-file
github.com/hashicorp/terraform/builtin/bins/provisioner-habitat
github.com/hashicorp/terraform/builtin/bins/provisioner-local-exec
github.com/hashicorp/terraform/builtin/bins/provisioner-remote-exec
github.com/hashicorp/terraform/builtin/bins/provisioner-salt-masterless
github.com/hashicorp/terraform/builtin/providers/terraform
github.com/hashicorp/terraform/builtin/providers/test
github.com/hashicorp/terraform/builtin/provisioners/chef
github.com/hashicorp/terraform/builtin/provisioners/file
github.com/hashicorp/terraform/builtin/provisioners/habitat
github.com/hashicorp/terraform/builtin/provisioners/local-exec
github.com/hashicorp/terraform/builtin/provisioners/remote-exec
github.com/hashicorp/terraform/builtin/provisioners/salt-masterless
github.com/hashicorp/terraform/command
github.com/hashicorp/terraform/command/clistate
github.com/hashicorp/terraform/command/e2etest
github.com/hashicorp/terraform/command/format
github.com/hashicorp/terraform/communicator
github.com/hashicorp/terraform/communicator/remote
github.com/hashicorp/terraform/communicator/shared
github.com/hashicorp/terraform/communicator/ssh
github.com/hashicorp/terraform/communicator/winrm
github.com/hashicorp/terraform/config
github.com/hashicorp/terraform/config/configschema
github.com/hashicorp/terraform/config/hcl2shim
github.com/hashicorp/terraform/config/module
github.com/hashicorp/terraform/dag
github.com/hashicorp/terraform/digraph
github.com/hashicorp/terraform/e2e
github.com/hashicorp/terraform/flatmap
github.com/hashicorp/terraform/helper/acctest
github.com/hashicorp/terraform/helper/config
github.com/hashicorp/terraform/helper/copy
github.com/hashicorp/terraform/helper/customdiff
github.com/hashicorp/terraform/helper/didyoumean
github.com/hashicorp/terraform/helper/diff
github.com/hashicorp/terraform/helper/encryption
github.com/hashicorp/terraform/helper/experiment
github.com/hashicorp/terraform/helper/hashcode
github.com/hashicorp/terraform/helper/hilmapstructure
github.com/hashicorp/terraform/helper/logging
github.com/hashicorp/terraform/helper/mutexkv
github.com/hashicorp/terraform/helper/pathorcontents
github.com/hashicorp/terraform/helper/resource
github.com/hashicorp/terraform/helper/schema
github.com/hashicorp/terraform/helper/shadow
github.com/hashicorp/terraform/helper/signalwrapper
github.com/hashicorp/terraform/helper/slowmessage
github.com/hashicorp/terraform/helper/structure
github.com/hashicorp/terraform/helper/validation
github.com/hashicorp/terraform/helper/variables
github.com/hashicorp/terraform/helper/wrappedreadline
github.com/hashicorp/terraform/helper/wrappedstreams
github.com/hashicorp/terraform/moduledeps
github.com/hashicorp/terraform/plugin
github.com/hashicorp/terraform/plugin/discovery
github.com/hashicorp/terraform/registry
github.com/hashicorp/terraform/registry/regsrc
github.com/hashicorp/terraform/registry/response
github.com/hashicorp/terraform/registry/test
github.com/hashicorp/terraform/repl
github.com/hashicorp/terraform/scripts
github.com/hashicorp/terraform/state
github.com/hashicorp/terraform/state/remote
github.com/hashicorp/terraform/svchost
github.com/hashicorp/terraform/svchost/auth
github.com/hashicorp/terraform/svchost/auth/test-helper
github.com/hashicorp/terraform/svchost/disco
github.com/hashicorp/terraform/terraform
github.com/hashicorp/terraform/tfdiags
github.com/hashicorp/terraform/tools/terraform-bundle
github.com/hashicorp/terraform/tools/terraform-bundle/e2etest
github.com/hashicorp/terraform/version
github.com/hashicorp/vault
github.com/hashicorp/vault/api
github.com/hashicorp/vault/audit
github.com/hashicorp/vault/builtin/audit/file
github.com/hashicorp/vault/builtin/audit/socket
github.com/hashicorp/vault/builtin/audit/syslog
github.com/hashicorp/vault/builtin/credential/app-id
github.com/hashicorp/vault/builtin/credential/approle
github.com/hashicorp/vault/builtin/credential/aws
github.com/hashicorp/vault/builtin/credential/cert
github.com/hashicorp/vault/builtin/credential/github
github.com/hashicorp/vault/builtin/credential/ldap
github.com/hashicorp/vault/builtin/credential/okta
github.com/hashicorp/vault/builtin/credential/radius
github.com/hashicorp/vault/builtin/credential/token
github.com/hashicorp/vault/builtin/credential/userpass
github.com/hashicorp/vault/builtin/logical/aws
github.com/hashicorp/vault/builtin/logical/cassandra
github.com/hashicorp/vault/builtin/logical/consul
github.com/hashicorp/vault/builtin/logical/database
github.com/hashicorp/vault/builtin/logical/database/dbplugin
github.com/hashicorp/vault/builtin/logical/mongodb
github.com/hashicorp/vault/builtin/logical/mssql
github.com/hashicorp/vault/builtin/logical/mysql
github.com/hashicorp/vault/builtin/logical/nomad
github.com/hashicorp/vault/builtin/logical/pki
github.com/hashicorp/vault/builtin/logical/postgresql
github.com/hashicorp/vault/builtin/logical/rabbitmq
github.com/hashicorp/vault/builtin/logical/ssh
github.com/hashicorp/vault/builtin/logical/totp
github.com/hashicorp/vault/builtin/logical/transit
github.com/hashicorp/vault/builtin/plugin
github.com/hashicorp/vault/command
github.com/hashicorp/vault/command/server
github.com/hashicorp/vault/command/token
github.com/hashicorp/vault/helper/awsutil
github.com/hashicorp/vault/helper/builtinplugins
github.com/hashicorp/vault/helper/certutil
github.com/hashicorp/vault/helper/cidrutil
github.com/hashicorp/vault/helper/compressutil
github.com/hashicorp/vault/helper/consts
github.com/hashicorp/vault/helper/errutil
github.com/hashicorp/vault/helper/flag-kv
github.com/hashicorp/vault/helper/flag-slice
github.com/hashicorp/vault/helper/forwarding
github.com/hashicorp/vault/helper/gated-writer
github.com/hashicorp/vault/helper/identity
github.com/hashicorp/vault/helper/jsonutil
github.com/hashicorp/vault/helper/kdf
github.com/hashicorp/vault/helper/keysutil
github.com/hashicorp/vault/helper/kv-builder
github.com/hashicorp/vault/helper/locksutil
github.com/hashicorp/vault/helper/logbridge
github.com/hashicorp/vault/helper/logformat
github.com/hashicorp/vault/helper/mfa
github.com/hashicorp/vault/helper/mfa/duo
github.com/hashicorp/vault/helper/mlock
github.com/hashicorp/vault/helper/parseutil
github.com/hashicorp/vault/helper/password
github.com/hashicorp/vault/helper/pgpkeys
github.com/hashicorp/vault/helper/pluginutil
github.com/hashicorp/vault/helper/policies
github.com/hashicorp/vault/helper/policyutil
github.com/hashicorp/vault/helper/proxyutil
github.com/hashicorp/vault/helper/reload
github.com/hashicorp/vault/helper/salt
github.com/hashicorp/vault/helper/storagepacker
github.com/hashicorp/vault/helper/strutil
github.com/hashicorp/vault/helper/tlsutil
github.com/hashicorp/vault/helper/wrapping
github.com/hashicorp/vault/helper/xor
github.com/hashicorp/vault/http
github.com/hashicorp/vault/logical
github.com/hashicorp/vault/logical/framework
github.com/hashicorp/vault/logical/plugin
github.com/hashicorp/vault/logical/plugin/mock
github.com/hashicorp/vault/logical/plugin/mock/mock-plugin
github.com/hashicorp/vault/logical/plugin/pb
github.com/hashicorp/vault/logical/testing
github.com/hashicorp/vault/physical
github.com/hashicorp/vault/physical/azure
github.com/hashicorp/vault/physical/cassandra
github.com/hashicorp/vault/physical/cockroachdb
github.com/hashicorp/vault/physical/consul
github.com/hashicorp/vault/physical/couchdb
github.com/hashicorp/vault/physical/dynamodb
github.com/hashicorp/vault/physical/etcd
github.com/hashicorp/vault/physical/file
github.com/hashicorp/vault/physical/gcs
github.com/hashicorp/vault/physical/inmem
github.com/hashicorp/vault/physical/mssql
github.com/hashicorp/vault/physical/mysql
github.com/hashicorp/vault/physical/postgresql
github.com/hashicorp/vault/physical/s3
github.com/hashicorp/vault/physical/swift
github.com/hashicorp/vault/physical/zookeeper
github.com/hashicorp/vault/plugins
github.com/hashicorp/vault/plugins/database/cassandra
github.com/hashicorp/vault/plugins/database/cassandra/cassandra-database-plugin
github.com/hashicorp/vault/plugins/database/hana
github.com/hashicorp/vault/plugins/database/hana/hana-database-plugin
github.com/hashicorp/vault/plugins/database/mongodb
github.com/hashicorp/vault/plugins/database/mongodb/mongodb-database-plugin
github.com/hashicorp/vault/plugins/database/mssql
github.com/hashicorp/vault/plugins/database/mssql/mssql-database-plugin
github.com/hashicorp/vault/plugins/database/mysql
github.com/hashicorp/vault/plugins/database/mysql/mysql-database-plugin
github.com/hashicorp/vault/plugins/database/mysql/mysql-legacy-database-plugin
github.com/hashicorp/vault/plugins/database/postgresql
github.com/hashicorp/vault/plugins/database/postgresql/postgresql-database-plugin
github.com/hashicorp/vault/plugins/helper/database/connutil
github.com/hashicorp/vault/plugins/helper/database/credsutil
github.com/hashicorp/vault/plugins/helper/database/dbutil
github.com/hashicorp/vault/shamir
github.com/hashicorp/vault/vault
github.com/hashicorp/vault/version
github.com/haya14busa/gopkgs
github.com/haya14busa/gopkgs/cmd/gopkgs
github.com/haya14busa/gopkgs/x/tools/imports
github.com/haya14busa/goplay
github.com/haya14busa/goplay/cmd/goplay
github.com/haya14busa/goplay/socket
github.com/hbagdi/go-unsplash/unsplash
github.com/hoop33/go-cyberark
github.com/hoop33/go-cyberark/examples
github.com/howeyc/fsnotify
github.com/howeyc/gopass
github.com/hprose/hprose-go
github.com/hprose/hprose-go/bench
github.com/hprose/hprose-go/examples
github.com/hprose/hprose-go/hprose
github.com/hprose/hprose-go/io
github.com/hprose/hprose-go/test
github.com/hybridgroup/go-ardrone/client
github.com/hybridgroup/go-ardrone/client/commands
github.com/hybridgroup/go-ardrone/client/navdata
github.com/hybridgroup/go-ardrone/cmd/ardrone
github.com/hybridgroup/go-ardrone/config
github.com/hybridgroup/go-ardrone/drivers/navboard
github.com/hybridgroup/go-ardrone/net/ftp
github.com/hybridgroup/go-ardrone/net/telnet
github.com/ivarg/goxsd
github.com/jackc/pgx
github.com/jackc/pgx/chunkreader
github.com/jackc/pgx/examples/chat
github.com/jackc/pgx/examples/todo
github.com/jackc/pgx/examples/url_shortener
github.com/jackc/pgx/internal/sanitize
github.com/jackc/pgx/log/log15adapter
github.com/jackc/pgx/log/logrusadapter
github.com/jackc/pgx/log/testingadapter
github.com/jackc/pgx/log/zapadapter
github.com/jackc/pgx/pgio
github.com/jackc/pgx/pgmock
github.com/jackc/pgx/pgproto3
github.com/jackc/pgx/pgtype
github.com/jackc/pgx/pgtype/ext/satori-uuid
github.com/jackc/pgx/pgtype/ext/shopspring-numeric
github.com/jackc/pgx/pgtype/testutil
github.com/jackc/pgx/stdlib
github.com/jawher/mow.cli
github.com/jawher/mow.cli/internal/container
github.com/jawher/mow.cli/internal/flow
github.com/jawher/mow.cli/internal/flow/flowdot
github.com/jawher/mow.cli/internal/fsm
github.com/jawher/mow.cli/internal/fsm/fsmdot
github.com/jawher/mow.cli/internal/fsm/fsmtest
github.com/jawher/mow.cli/internal/lexer
github.com/jawher/mow.cli/internal/matcher
github.com/jawher/mow.cli/internal/matcher/matchertest
github.com/jawher/mow.cli/internal/parser
github.com/jawher/mow.cli/internal/values
github.com/jcmturner/asn1
github.com/jcmturner/asn1/identicalsrc
github.com/jdkato/prose
github.com/jdkato/prose/chunk
github.com/jdkato/prose/cmd/prose
github.com/jdkato/prose/internal/model
github.com/jdkato/prose/internal/util
github.com/jdkato/prose/summarize
github.com/jdkato/prose/tag
github.com/jdkato/prose/tokenize
github.com/jdkato/prose/transform
github.com/jessevdk/go-flags
github.com/jessevdk/go-flags/examples
github.com/jimstudt/http-authentication/basic
github.com/jimstudt/http-authentication/digest
github.com/jinzhu/gorm
github.com/jinzhu/gorm/dialects/mssql
github.com/jinzhu/gorm/dialects/mysql
github.com/jinzhu/gorm/dialects/postgres
github.com/jinzhu/gorm/dialects/sqlite
github.com/jinzhu/inflection
github.com/jmoiron/sqlx
github.com/jmoiron/sqlx/reflectx
github.com/jmoiron/sqlx/types
github.com/joho/godotenv
github.com/joho/godotenv/autoload
github.com/joho/godotenv/cmd/godotenv
github.com/josharian/goversion
github.com/josharian/impl
github.com/jroimartin/gocui
github.com/json-iterator/go
github.com/json-iterator/go/extra
github.com/json-iterator/go/output_tests
github.com/json-iterator/go/output_tests/array/array/bool
github.com/json-iterator/go/output_tests/array/array/byte
github.com/json-iterator/go/output_tests/array/array/float64
github.com/json-iterator/go/output_tests/array/array/int32
github.com/json-iterator/go/output_tests/array/array/ptr_string
github.com/json-iterator/go/output_tests/array/array/string
github.com/json-iterator/go/output_tests/array/array/uint8
github.com/json-iterator/go/output_tests/array/bool
github.com/json-iterator/go/output_tests/array/byte
github.com/json-iterator/go/output_tests/array/float64
github.com/json-iterator/go/output_tests/array/int32
github.com/json-iterator/go/output_tests/array/map/int32_string
github.com/json-iterator/go/output_tests/array/map/string_string
github.com/json-iterator/go/output_tests/array/ptr_bool
github.com/json-iterator/go/output_tests/array/ptr_float64
github.com/json-iterator/go/output_tests/array/ptr_int32
github.com/json-iterator/go/output_tests/array/ptr_map/int32_string
github.com/json-iterator/go/output_tests/array/ptr_map/string_string
github.com/json-iterator/go/output_tests/array/ptr_slice/bool
github.com/json-iterator/go/output_tests/array/ptr_slice/byte
github.com/json-iterator/go/output_tests/array/ptr_slice/float64
github.com/json-iterator/go/output_tests/array/ptr_slice/int32
github.com/json-iterator/go/output_tests/array/ptr_slice/ptr_string
github.com/json-iterator/go/output_tests/array/ptr_slice/string
github.com/json-iterator/go/output_tests/array/ptr_slice/uint8
github.com/json-iterator/go/output_tests/array/ptr_string
github.com/json-iterator/go/output_tests/array/ptr_struct_various
github.com/json-iterator/go/output_tests/array/ptr_uint8
github.com/json-iterator/go/output_tests/array/slice/bool
github.com/json-iterator/go/output_tests/array/slice/byte
github.com/json-iterator/go/output_tests/array/slice/float64
github.com/json-iterator/go/output_tests/array/slice/int32
github.com/json-iterator/go/output_tests/array/slice/ptr_string
github.com/json-iterator/go/output_tests/array/slice/string
github.com/json-iterator/go/output_tests/array/slice/uint8
github.com/json-iterator/go/output_tests/array/string
github.com/json-iterator/go/output_tests/array/struct_empty
github.com/json-iterator/go/output_tests/array/struct_empty_alias
github.com/json-iterator/go/output_tests/array/struct_ptr_string
github.com/json-iterator/go/output_tests/array/struct_various
github.com/json-iterator/go/output_tests/array/uint8
github.com/json-iterator/go/output_tests/builtins/bool
github.com/json-iterator/go/output_tests/builtins/bool_alias
github.com/json-iterator/go/output_tests/builtins/byte
github.com/json-iterator/go/output_tests/builtins/byte_alias
github.com/json-iterator/go/output_tests/builtins/float32
github.com/json-iterator/go/output_tests/builtins/float32_alias
github.com/json-iterator/go/output_tests/builtins/float64
github.com/json-iterator/go/output_tests/builtins/float64_alias
github.com/json-iterator/go/output_tests/builtins/int16
github.com/json-iterator/go/output_tests/builtins/int16_alias
github.com/json-iterator/go/output_tests/builtins/int32
github.com/json-iterator/go/output_tests/builtins/int32_alias
github.com/json-iterator/go/output_tests/builtins/int64
github.com/json-iterator/go/output_tests/builtins/int8
github.com/json-iterator/go/output_tests/builtins/int8_alias
github.com/json-iterator/go/output_tests/builtins/string
github.com/json-iterator/go/output_tests/builtins/string_alias
github.com/json-iterator/go/output_tests/builtins/uint16
github.com/json-iterator/go/output_tests/builtins/uint16_alias
github.com/json-iterator/go/output_tests/builtins/uint32
github.com/json-iterator/go/output_tests/builtins/uint32_alias
github.com/json-iterator/go/output_tests/builtins/uint8
github.com/json-iterator/go/output_tests/builtins/uint8_alias
github.com/json-iterator/go/output_tests/builtins/uintptr
github.com/json-iterator/go/output_tests/caseless_unmarshal
github.com/json-iterator/go/output_tests/json_marshal/string_alias
github.com/json-iterator/go/output_tests/json_marshal/struct
github.com/json-iterator/go/output_tests/json_marshal/struct_alias
github.com/json-iterator/go/output_tests/json_marshal/struct_field
github.com/json-iterator/go/output_tests/json_marshal/struct_field_alias
github.com/json-iterator/go/output_tests/map/int16/string
github.com/json-iterator/go/output_tests/map/int32/string
github.com/json-iterator/go/output_tests/map/int64/string
github.com/json-iterator/go/output_tests/map/int8/string
github.com/json-iterator/go/output_tests/map/string/array_string
github.com/json-iterator/go/output_tests/map/string/bool
github.com/json-iterator/go/output_tests/map/string/byte
github.com/json-iterator/go/output_tests/map/string/float64
github.com/json-iterator/go/output_tests/map/string/int32
github.com/json-iterator/go/output_tests/map/string/map_string_string
github.com/json-iterator/go/output_tests/map/string/ptr_array_string
github.com/json-iterator/go/output_tests/map/string/ptr_bool
github.com/json-iterator/go/output_tests/map/string/ptr_float64
github.com/json-iterator/go/output_tests/map/string/ptr_int32
github.com/json-iterator/go/output_tests/map/string/ptr_map_string_string
github.com/json-iterator/go/output_tests/map/string/ptr_slice_string
github.com/json-iterator/go/output_tests/map/string/ptr_string
github.com/json-iterator/go/output_tests/map/string/ptr_struct_various
github.com/json-iterator/go/output_tests/map/string/ptr_uint8
github.com/json-iterator/go/output_tests/map/string/slice_string
github.com/json-iterator/go/output_tests/map/string/string
github.com/json-iterator/go/output_tests/map/string/string_alias
github.com/json-iterator/go/output_tests/map/string/struct_empty
github.com/json-iterator/go/output_tests/map/string/struct_empty_alias
github.com/json-iterator/go/output_tests/map/string/struct_ptr_string
github.com/json-iterator/go/output_tests/map/string/struct_various
github.com/json-iterator/go/output_tests/map/string/uint8
github.com/json-iterator/go/output_tests/map/string_alias/string
github.com/json-iterator/go/output_tests/map/string_alias/string_alias
github.com/json-iterator/go/output_tests/map/uint16/string
github.com/json-iterator/go/output_tests/map/uint32/string
github.com/json-iterator/go/output_tests/map/uint8/string
github.com/json-iterator/go/output_tests/map_key_text_marshal/string_alias
github.com/json-iterator/go/output_tests/map_key_text_marshal/struct
github.com/json-iterator/go/output_tests/partial_unmarshal
github.com/json-iterator/go/output_tests/slice/array/bool
github.com/json-iterator/go/output_tests/slice/array/byte
github.com/json-iterator/go/output_tests/slice/array/float64
github.com/json-iterator/go/output_tests/slice/array/int32
github.com/json-iterator/go/output_tests/slice/array/ptr_string
github.com/json-iterator/go/output_tests/slice/array/string
github.com/json-iterator/go/output_tests/slice/array/uint8
github.com/json-iterator/go/output_tests/slice/bool
github.com/json-iterator/go/output_tests/slice/byte
github.com/json-iterator/go/output_tests/slice/float64
github.com/json-iterator/go/output_tests/slice/int32
github.com/json-iterator/go/output_tests/slice/int64
github.com/json-iterator/go/output_tests/slice/map/int32_string
github.com/json-iterator/go/output_tests/slice/map/string_string
github.com/json-iterator/go/output_tests/slice/ptr_array/bool
github.com/json-iterator/go/output_tests/slice/ptr_array/byte
github.com/json-iterator/go/output_tests/slice/ptr_array/float64
github.com/json-iterator/go/output_tests/slice/ptr_array/int32
github.com/json-iterator/go/output_tests/slice/ptr_array/ptr_string
github.com/json-iterator/go/output_tests/slice/ptr_array/string
github.com/json-iterator/go/output_tests/slice/ptr_array/uint8
github.com/json-iterator/go/output_tests/slice/ptr_bool
github.com/json-iterator/go/output_tests/slice/ptr_float64
github.com/json-iterator/go/output_tests/slice/ptr_int32
github.com/json-iterator/go/output_tests/slice/ptr_map/int32_string
github.com/json-iterator/go/output_tests/slice/ptr_map/string_string
github.com/json-iterator/go/output_tests/slice/ptr_slice/bool
github.com/json-iterator/go/output_tests/slice/ptr_slice/byte
github.com/json-iterator/go/output_tests/slice/ptr_slice/float64
github.com/json-iterator/go/output_tests/slice/ptr_slice/int32
github.com/json-iterator/go/output_tests/slice/ptr_slice/ptr_string
github.com/json-iterator/go/output_tests/slice/ptr_slice/string
github.com/json-iterator/go/output_tests/slice/ptr_slice/uint8
github.com/json-iterator/go/output_tests/slice/ptr_string
github.com/json-iterator/go/output_tests/slice/ptr_struct_various
github.com/json-iterator/go/output_tests/slice/ptr_uint8
github.com/json-iterator/go/output_tests/slice/slice/bool
github.com/json-iterator/go/output_tests/slice/slice/byte
github.com/json-iterator/go/output_tests/slice/slice/float64
github.com/json-iterator/go/output_tests/slice/slice/int32
github.com/json-iterator/go/output_tests/slice/slice/ptr_string
github.com/json-iterator/go/output_tests/slice/slice/string
github.com/json-iterator/go/output_tests/slice/slice/uint8
github.com/json-iterator/go/output_tests/slice/string
github.com/json-iterator/go/output_tests/slice/struct_empty
github.com/json-iterator/go/output_tests/slice/struct_empty_alias
github.com/json-iterator/go/output_tests/slice/struct_ptr_string
github.com/json-iterator/go/output_tests/slice/struct_various
github.com/json-iterator/go/output_tests/slice/uint8
github.com/json-iterator/go/output_tests/struct/alias
github.com/json-iterator/go/output_tests/struct/anonymous/no_overlap/float64
github.com/json-iterator/go/output_tests/struct/anonymous/no_overlap/int32
github.com/json-iterator/go/output_tests/struct/anonymous/no_overlap/json_marshal
github.com/json-iterator/go/output_tests/struct/anonymous/no_overlap/map_string_string
github.com/json-iterator/go/output_tests/struct/anonymous/no_overlap/ptr_float64
github.com/json-iterator/go/output_tests/struct/anonymous/no_overlap/ptr_int32
github.com/json-iterator/go/output_tests/struct/anonymous/no_overlap/ptr_map_string_string
github.com/json-iterator/go/output_tests/struct/anonymous/no_overlap/ptr_slice_string
github.com/json-iterator/go/output_tests/struct/anonymous/no_overlap/ptr_string
github.com/json-iterator/go/output_tests/struct/anonymous/no_overlap/ptr_struct_various
github.com/json-iterator/go/output_tests/struct/anonymous/no_overlap/slice_string
github.com/json-iterator/go/output_tests/struct/anonymous/no_overlap/string
github.com/json-iterator/go/output_tests/struct/anonymous/no_overlap/string_with_tag
github.com/json-iterator/go/output_tests/struct/anonymous/no_overlap/struct_various
github.com/json-iterator/go/output_tests/struct/anonymous/no_overlap/text_marshal
github.com/json-iterator/go/output_tests/struct/anonymous/overlap/different_levels
github.com/json-iterator/go/output_tests/struct/anonymous/overlap/ignore_deeper_level
github.com/json-iterator/go/output_tests/struct/anonymous/overlap/same_level_1_both_tagged
github.com/json-iterator/go/output_tests/struct/anonymous/overlap/same_level_1_no_tags
github.com/json-iterator/go/output_tests/struct/anonymous/overlap/same_level_1_tagged
github.com/json-iterator/go/output_tests/struct/anonymous/overlap/same_level_2_both_tagged
github.com/json-iterator/go/output_tests/struct/anonymous/overlap/same_level_2_no_tags
github.com/json-iterator/go/output_tests/struct/anonymous/overlap/same_level_2_tagged
github.com/json-iterator/go/output_tests/struct/array/ptr_string
github.com/json-iterator/go/output_tests/struct/array/string
github.com/json-iterator/go/output_tests/struct/array/string_alias
github.com/json-iterator/go/output_tests/struct/array/strings
github.com/json-iterator/go/output_tests/struct/array/struct_strings
github.com/json-iterator/go/output_tests/struct/empty
github.com/json-iterator/go/output_tests/struct/empty_alias
github.com/json-iterator/go/output_tests/struct/everything
github.com/json-iterator/go/output_tests/struct/float64
github.com/json-iterator/go/output_tests/struct/float64_alias
github.com/json-iterator/go/output_tests/struct/float64s
github.com/json-iterator/go/output_tests/struct/float64s_alias
github.com/json-iterator/go/output_tests/struct/int32
github.com/json-iterator/go/output_tests/struct/int32_alias
github.com/json-iterator/go/output_tests/struct/int32s
github.com/json-iterator/go/output_tests/struct/int32s_alias
github.com/json-iterator/go/output_tests/struct/int64
github.com/json-iterator/go/output_tests/struct/map/int32_ptr_string
github.com/json-iterator/go/output_tests/struct/map/int32_string
github.com/json-iterator/go/output_tests/struct/map/int32_struct_strings
github.com/json-iterator/go/output_tests/struct/map/string_ptr_string
github.com/json-iterator/go/output_tests/struct/map/string_string
github.com/json-iterator/go/output_tests/struct/map/string_struct_strings
github.com/json-iterator/go/output_tests/struct/ptr_float64
github.com/json-iterator/go/output_tests/struct/ptr_float64_alias
github.com/json-iterator/go/output_tests/struct/ptr_int32
github.com/json-iterator/go/output_tests/struct/ptr_int32_alias
github.com/json-iterator/go/output_tests/struct/ptr_ptr_struct_empty
github.com/json-iterator/go/output_tests/struct/ptr_ptr_struct_strings
github.com/json-iterator/go/output_tests/struct/ptr_string
github.com/json-iterator/go/output_tests/struct/ptr_string_alias
github.com/json-iterator/go/output_tests/struct/ptr_struct_empty
github.com/json-iterator/go/output_tests/struct/ptr_struct_strings
github.com/json-iterator/go/output_tests/struct/ptrs_float64
github.com/json-iterator/go/output_tests/struct/ptrs_int32
github.com/json-iterator/go/output_tests/struct/ptrs_string
github.com/json-iterator/go/output_tests/struct/slice/ptr_string
github.com/json-iterator/go/output_tests/struct/slice/string
github.com/json-iterator/go/output_tests/struct/slice/string_alias
github.com/json-iterator/go/output_tests/struct/slice/strings
github.com/json-iterator/go/output_tests/struct/slice/struct_strings
github.com/json-iterator/go/output_tests/struct/string
github.com/json-iterator/go/output_tests/struct/string_alias
github.com/json-iterator/go/output_tests/struct/strings
github.com/json-iterator/go/output_tests/struct/strings_alias
github.com/json-iterator/go/output_tests/struct/struct/empties
github.com/json-iterator/go/output_tests/struct/struct/empty
github.com/json-iterator/go/output_tests/struct/struct/empty_alias
github.com/json-iterator/go/output_tests/struct/struct/float32s
github.com/json-iterator/go/output_tests/struct/struct/float64
github.com/json-iterator/go/output_tests/struct/struct/float64_alias
github.com/json-iterator/go/output_tests/struct/struct/int32s
github.com/json-iterator/go/output_tests/struct/struct/strings
github.com/json-iterator/go/output_tests/struct/struct/strings_alias
github.com/json-iterator/go/output_tests/struct_tags/fieldname/embedded
github.com/json-iterator/go/output_tests/struct_tags/fieldname/string
github.com/json-iterator/go/output_tests/struct_tags/fieldname/struct
github.com/json-iterator/go/output_tests/struct_tags/omitempty/bool
github.com/json-iterator/go/output_tests/struct_tags/omitempty/embedded
github.com/json-iterator/go/output_tests/struct_tags/omitempty/float32
github.com/json-iterator/go/output_tests/struct_tags/omitempty/int32
github.com/json-iterator/go/output_tests/struct_tags/omitempty/map_string_string
github.com/json-iterator/go/output_tests/struct_tags/omitempty/ptr_bool
github.com/json-iterator/go/output_tests/struct_tags/omitempty/ptr_float32
github.com/json-iterator/go/output_tests/struct_tags/omitempty/ptr_int32
github.com/json-iterator/go/output_tests/struct_tags/omitempty/ptr_map_string_string
github.com/json-iterator/go/output_tests/struct_tags/omitempty/ptr_slice_string
github.com/json-iterator/go/output_tests/struct_tags/omitempty/ptr_string
github.com/json-iterator/go/output_tests/struct_tags/omitempty/ptr_string/string
github.com/json-iterator/go/output_tests/struct_tags/omitempty/ptr_string_json_marshal
github.com/json-iterator/go/output_tests/struct_tags/omitempty/ptr_string_text_marshal
github.com/json-iterator/go/output_tests/struct_tags/omitempty/ptr_struct_json_marshal
github.com/json-iterator/go/output_tests/struct_tags/omitempty/ptr_struct_text_marshal
github.com/json-iterator/go/output_tests/struct_tags/omitempty/ptr_uint32
github.com/json-iterator/go/output_tests/struct_tags/omitempty/slice_string
github.com/json-iterator/go/output_tests/struct_tags/omitempty/string
github.com/json-iterator/go/output_tests/struct_tags/omitempty/string_json_marshal
github.com/json-iterator/go/output_tests/struct_tags/omitempty/string_text_marshal
github.com/json-iterator/go/output_tests/struct_tags/omitempty/struct
github.com/json-iterator/go/output_tests/struct_tags/omitempty/struct_json_marshal
github.com/json-iterator/go/output_tests/struct_tags/omitempty/struct_text_marshal
github.com/json-iterator/go/output_tests/struct_tags/omitempty/uint32
github.com/json-iterator/go/output_tests/struct_tags/string/bool
github.com/json-iterator/go/output_tests/struct_tags/string/byte
github.com/json-iterator/go/output_tests/struct_tags/string/float32
github.com/json-iterator/go/output_tests/struct_tags/string/float64
github.com/json-iterator/go/output_tests/struct_tags/string/int16
github.com/json-iterator/go/output_tests/struct_tags/string/int32
github.com/json-iterator/go/output_tests/struct_tags/string/int8
github.com/json-iterator/go/output_tests/struct_tags/string/string
github.com/json-iterator/go/output_tests/struct_tags/string/uint16
github.com/json-iterator/go/output_tests/struct_tags/string/uint32
github.com/json-iterator/go/output_tests/struct_tags/string/uint8
github.com/json-iterator/go/output_tests/text_marshal/string_alias
github.com/json-iterator/go/output_tests/text_marshal/struct
github.com/json-iterator/go/output_tests/text_marshal/struct_alias
github.com/json-iterator/go/output_tests/text_marshal/struct_field
github.com/json-iterator/go/output_tests/text_marshal/struct_field_alias
github.com/json-iterator/go/skip_tests/array
github.com/json-iterator/go/skip_tests/number
github.com/json-iterator/go/skip_tests/object
github.com/json-iterator/go/skip_tests/string
github.com/jstemmer/gotags
github.com/jteeuwen/go-bindata
github.com/jteeuwen/go-bindata/go-bindata
github.com/jtolds/gls
github.com/juju/ansiterm
github.com/juju/ansiterm/tabwriter
github.com/justjanne/powerline-go
github.com/justwatchcom/gopass
github.com/justwatchcom/gopass/action
github.com/justwatchcom/gopass/backend/crypto/gpg
github.com/justwatchcom/gopass/backend/crypto/gpg/cli
github.com/justwatchcom/gopass/backend/crypto/gpg/mock
github.com/justwatchcom/gopass/backend/sync/git/cli
github.com/justwatchcom/gopass/backend/sync/git/gogit
github.com/justwatchcom/gopass/backend/sync/git/mock
github.com/justwatchcom/gopass/config
github.com/justwatchcom/gopass/store
github.com/justwatchcom/gopass/store/root
github.com/justwatchcom/gopass/store/secret
github.com/justwatchcom/gopass/store/sub
github.com/justwatchcom/gopass/tests
github.com/justwatchcom/gopass/tests/gptest
github.com/justwatchcom/gopass/utils/completion/fish
github.com/justwatchcom/gopass/utils/completion/zsh
github.com/justwatchcom/gopass/utils/ctxutil
github.com/justwatchcom/gopass/utils/cui
github.com/justwatchcom/gopass/utils/fsutil
github.com/justwatchcom/gopass/utils/jsonapi
github.com/justwatchcom/gopass/utils/jsonapi/manifest
github.com/justwatchcom/gopass/utils/notify
github.com/justwatchcom/gopass/utils/out
github.com/justwatchcom/gopass/utils/protect
github.com/justwatchcom/gopass/utils/pwgen
github.com/justwatchcom/gopass/utils/pwgen/xkcdgen
github.com/justwatchcom/gopass/utils/qrcon
github.com/justwatchcom/gopass/utils/tempfile
github.com/justwatchcom/gopass/utils/termio
github.com/justwatchcom/gopass/utils/termutil
github.com/justwatchcom/gopass/utils/termwiz
github.com/justwatchcom/gopass/utils/tpl
github.com/justwatchcom/gopass/utils/tree
github.com/justwatchcom/gopass/utils/tree/simple
github.com/k-sone/snmpgo
github.com/k-sone/snmpgo/examples
github.com/k-sone/snmpgo/snmptest
github.com/k0kubun/pp
github.com/karan/joe
github.com/kardianos/govendor
github.com/kardianos/govendor/cliprompt
github.com/kardianos/govendor/context
github.com/kardianos/govendor/help
github.com/kardianos/govendor/internal/gt
github.com/kardianos/govendor/internal/pathos
github.com/kardianos/govendor/internal/vfilepath
github.com/kardianos/govendor/internal/vos
github.com/kardianos/govendor/migrate
github.com/kardianos/govendor/pkgspec
github.com/kardianos/govendor/prompt
github.com/kardianos/govendor/run
github.com/kardianos/govendor/vcs
github.com/kardianos/govendor/vendorfile
github.com/kardianos/osext
github.com/kenshaw/go-arg
github.com/kisielk/errcheck
github.com/kisielk/errcheck/internal/errcheck
github.com/kisielk/godepgraph
github.com/kisielk/gotool
github.com/kisielk/gotool/internal/load
github.com/klauern/adr_web
github.com/klauern/adr_web/actions
github.com/klauern/adr_web/grifts
github.com/klauern/adr_web/models
github.com/klauern/adventcode-2016/day1
github.com/klauern/adventcode-2016/day10
github.com/klauern/adventcode-2016/day11
github.com/klauern/adventcode-2016/day12
github.com/klauern/adventcode-2016/day2
github.com/klauern/adventcode-2016/day3
github.com/klauern/adventcode-2016/day4
github.com/klauern/adventcode-2016/day5
github.com/klauern/adventcode-2016/day6
github.com/klauern/adventcode-2016/day7
github.com/klauern/adventcode-2016/day9
github.com/klauern/adventcode-2016/day9-naive
github.com/klauern/adventcode-2016/helpers
github.com/klauern/coke
github.com/klauern/coke/actions
github.com/klauern/coke/grifts
github.com/klauern/coke/models
github.com/klauern/cyberark
github.com/klauern/getMOSPatch
github.com/klauern/getMOSPatch/cmd
github.com/klauern/go-adr
github.com/klauern/go-adr/adr
github.com/klauern/go-adr/cmd
github.com/klauern/gojenkins
github.com/klauern/gojenkins/api
github.com/klauern/jenkins-xsd-schema/0.0.0.0:8080/schema.xsd_go
github.com/klauern/keepasser
github.com/klauern/keepasser/cli
github.com/klauern/keepasser/cli/cmd
github.com/klauern/keystore-kickstart
github.com/klauern/oem-ansible-groupings
github.com/klauern/oldgojenkins
github.com/klauern/ora-test
github.com/klauern/ora-test/rana
github.com/klauern/ora-test/sqlx
github.com/klauern/osb-lint/cmd
github.com/klauern/printshop
github.com/klauern/printshop/cmd
github.com/klauern/printshop/cmd/printshop
github.com/klauern/remy
github.com/klauern/remy/cmd
github.com/klauern/remy/cmd/remy
github.com/klauern/rollin_dollas/cmd
github.com/klauern/shellchecker
github.com/klauern/shellchecker/actions
github.com/klauern/shellchecker/grifts
github.com/klauern/trackello
github.com/klauern/trackello/cmd
github.com/klauern/trackello/cmd/trackello
github.com/klauern/trackello/rest
github.com/klauern/tunnellergy
github.com/klauern/tunnellergy/tun
github.com/klauern/tunnellergy/tun/cmd
github.com/klauern/wls-resources
github.com/klauern/wls-resources/actions
github.com/klauern/wls-resources/grifts
github.com/klauern/wls-resources/models
github.com/klauspost/asmfmt
github.com/klauspost/asmfmt/cmd/asmfmt
github.com/klauspost/asmfmt/cmd/gofmt
github.com/klauspost/asmfmt/cmd/gofmt/format
github.com/klauspost/asmfmt/cmd/goimports
github.com/klauspost/asmfmt/cmd/goreturns
github.com/knq/chromedp
github.com/knq/chromedp/client
github.com/knq/chromedp/kb
github.com/knq/chromedp/runner
github.com/knq/dburl
github.com/knq/dburl/example
github.com/knq/sysutil
github.com/knq/sysutil/cmd/boottime
github.com/knq/usql
github.com/knq/usql/drivers
github.com/knq/usql/drivers/adodb
github.com/knq/usql/drivers/avatica
github.com/knq/usql/drivers/clickhouse
github.com/knq/usql/drivers/couchbase
github.com/knq/usql/drivers/firebird
github.com/knq/usql/drivers/mssql
github.com/knq/usql/drivers/mymysql
github.com/knq/usql/drivers/mysql
github.com/knq/usql/drivers/odbc
github.com/knq/usql/drivers/oracle
github.com/knq/usql/drivers/pgx
github.com/knq/usql/drivers/postgres
github.com/knq/usql/drivers/presto
github.com/knq/usql/drivers/ql
github.com/knq/usql/drivers/saphana
github.com/knq/usql/drivers/sqlite3
github.com/knq/usql/drivers/voltdb
github.com/knq/usql/env
github.com/knq/usql/handler
github.com/knq/usql/internal
github.com/knq/usql/metacmd
github.com/knq/usql/rline
github.com/knq/usql/stmt
github.com/knq/usql/styles
github.com/knq/usql/text
github.com/knq/xoutil
github.com/knqyf263/go-deb-version
github.com/knqyf263/go-rpm-version
github.com/knqyf263/pet
github.com/knqyf263/pet/cmd
github.com/knqyf263/pet/config
github.com/knqyf263/pet/dialog
github.com/knqyf263/pet/snippet
github.com/knqyf263/pet/sync
github.com/kotakanbe/go-cve-dictionary
github.com/kotakanbe/go-cve-dictionary/commands
github.com/kotakanbe/go-cve-dictionary/config
github.com/kotakanbe/go-cve-dictionary/db
github.com/kotakanbe/go-cve-dictionary/jvn
github.com/kotakanbe/go-cve-dictionary/log
github.com/kotakanbe/go-cve-dictionary/models
github.com/kotakanbe/go-cve-dictionary/nvd
github.com/kotakanbe/go-cve-dictionary/server
github.com/kotakanbe/go-cve-dictionary/util
github.com/kotakanbe/go-pingscanner
github.com/kotakanbe/go-pingscanner/example
github.com/kotakanbe/goval-dictionary
github.com/kotakanbe/goval-dictionary/commands
github.com/kotakanbe/goval-dictionary/config
github.com/kotakanbe/goval-dictionary/db
github.com/kotakanbe/goval-dictionary/db/rdb
github.com/kotakanbe/goval-dictionary/fetcher
github.com/kotakanbe/goval-dictionary/log
github.com/kotakanbe/goval-dictionary/models
github.com/kotakanbe/goval-dictionary/server
github.com/kotakanbe/goval-dictionary/util
github.com/kotakanbe/logrus-prefixed-formatter
github.com/kotakanbe/logrus-prefixed-formatter/examples
github.com/kr/fs
github.com/kr/pretty
github.com/kr/pty
github.com/kr/text
github.com/kr/text/cmd/agg
github.com/kr/text/colwriter
github.com/kr/text/mc
github.com/kshvakov/clickhouse
github.com/kshvakov/clickhouse/examples
github.com/kshvakov/clickhouse/lib/binary
github.com/kshvakov/clickhouse/lib/column
github.com/kshvakov/clickhouse/lib/data
github.com/kshvakov/clickhouse/lib/protocol
github.com/kshvakov/clickhouse/lib/types
github.com/kshvakov/clickhouse/lib/writebuffer
github.com/kshvmdn/point
github.com/kshvmdn/point/cmd/point
github.com/kshvmdn/point/template
github.com/kshvmdn/point/version
github.com/kshvmdn/shorten
github.com/kshvmdn/shorten/cmd/point
github.com/kshvmdn/shorten/template
github.com/kshvmdn/shorten/version
github.com/kuba--/splunk
github.com/kuba--/splunk/cmd/info
github.com/kuba--/splunk/cmd/search
github.com/kyoh86/richgo
github.com/kyoh86/richgo/config
github.com/kyoh86/richgo/editor
github.com/kyoh86/richgo/editor/test
github.com/kyokomi/emoji
github.com/kyokomi/emoji/example
github.com/labstack/echo
github.com/labstack/echo/middleware
github.com/labstack/gommon
github.com/labstack/gommon/bytes
github.com/labstack/gommon/color
github.com/labstack/gommon/email
github.com/labstack/gommon/log
github.com/labstack/gommon/random
github.com/lazywei/go-opencv
github.com/lazywei/go-opencv/gocv
github.com/lazywei/go-opencv/opencv
github.com/lazywei/go-opencv/samples
github.com/lestrrat/go-pdebug
github.com/lib/pq
github.com/lib/pq/example/listen
github.com/lib/pq/hstore
github.com/lib/pq/oid
github.com/libvirt/libvirt-go
github.com/linkedin/goavro
github.com/linkedin/goavro/examples/ab2t
github.com/linkedin/goavro/examples/arw
github.com/linkedin/goavro/examples/avroheader
github.com/linkedin/goavro/examples/nested
github.com/linkedin/goavro/examples/splice
github.com/lucas-clemente/aes12
github.com/lucas-clemente/fnv128a
github.com/lucas-clemente/quic-go
github.com/lucas-clemente/quic-go/ackhandler
github.com/lucas-clemente/quic-go/benchmark
github.com/lucas-clemente/quic-go/congestion
github.com/lucas-clemente/quic-go/example
github.com/lucas-clemente/quic-go/example/client
github.com/lucas-clemente/quic-go/example/echo
github.com/lucas-clemente/quic-go/h2quic
github.com/lucas-clemente/quic-go/integrationtests/chrome
github.com/lucas-clemente/quic-go/integrationtests/gquic
github.com/lucas-clemente/quic-go/integrationtests/self
github.com/lucas-clemente/quic-go/integrationtests/tools/proxy
github.com/lucas-clemente/quic-go/integrationtests/tools/testlog
github.com/lucas-clemente/quic-go/integrationtests/tools/testserver
github.com/lucas-clemente/quic-go/internal/crypto
github.com/lucas-clemente/quic-go/internal/flowcontrol
github.com/lucas-clemente/quic-go/internal/handshake
github.com/lucas-clemente/quic-go/internal/mocks
github.com/lucas-clemente/quic-go/internal/mocks/ackhandler
github.com/lucas-clemente/quic-go/internal/mocks/crypto
github.com/lucas-clemente/quic-go/internal/mocks/handshake
github.com/lucas-clemente/quic-go/internal/protocol
github.com/lucas-clemente/quic-go/internal/utils
github.com/lucas-clemente/quic-go/internal/wire
github.com/lucas-clemente/quic-go/qerr
github.com/lucas-clemente/quic-go-certificates
github.com/lukehoban/go-outline
github.com/lunixbochs/vtclean
github.com/lunixbochs/vtclean/vtclean
github.com/lunny/log
github.com/magiconair/properties
github.com/magiconair/properties/assert
github.com/mailgun/log
github.com/mailgun/mailgun-go
github.com/mailgun/mailgun-go/cmd/mailgun
github.com/mailru/easyjson
github.com/mailru/easyjson/benchmark
github.com/mailru/easyjson/bootstrap
github.com/mailru/easyjson/buffer
github.com/mailru/easyjson/easyjson
github.com/mailru/easyjson/gen
github.com/mailru/easyjson/jlexer
github.com/mailru/easyjson/jwriter
github.com/mailru/easyjson/opt
github.com/mailru/easyjson/parser
github.com/mailru/easyjson/tests
github.com/manifoldco/promptui
github.com/manifoldco/promptui/list
github.com/manifoldco/promptui/screenbuf
github.com/markbates/deplist
github.com/markbates/deplist/deplist
github.com/markbates/gentronics
github.com/markbates/going/clam
github.com/markbates/going/defaults
github.com/markbates/going/imt
github.com/markbates/going/randx
github.com/markbates/going/validate
github.com/markbates/going/validate/validators
github.com/markbates/going/wait
github.com/markbates/grift
github.com/markbates/grift/cmd
github.com/markbates/grift/grift
github.com/markbates/hmax
github.com/markbates/inflect
github.com/markbates/pop
github.com/markbates/pop/columns
github.com/markbates/pop/fizz
github.com/markbates/pop/fizz/translators
github.com/markbates/pop/grifts
github.com/markbates/pop/nulls
github.com/markbates/pop/slices
github.com/markbates/pop/soda
github.com/markbates/pop/soda/cmd
github.com/markbates/pop/soda/cmd/generate
github.com/markbates/pop/soda/cmd/schema
github.com/markbates/refresh
github.com/markbates/refresh/cmd
github.com/markbates/refresh/grifts
github.com/markbates/refresh/refresh
github.com/markbates/refresh/refresh/web
github.com/markbates/sigtx
github.com/markbates/tt
github.com/markbates/tt/cmd
github.com/markbates/tt/cmd/models
github.com/markbates/validate
github.com/markbates/validate/validators
github.com/markbates/willie
github.com/marshallbrekka/go-u2fhost
github.com/marshallbrekka/go-u2fhost/bytes
github.com/marshallbrekka/go-u2fhost/cmd
github.com/marshallbrekka/go-u2fhost/hid
github.com/marstr/guid
github.com/maruel/panicparse
github.com/maruel/panicparse/cmd/panic
github.com/maruel/panicparse/cmd/panic/internal
github.com/maruel/panicparse/cmd/pp
github.com/maruel/panicparse/internal
github.com/maruel/panicparse/stack
github.com/masterminds/semver
github.com/mattn/anko
github.com/mattn/anko/ast
github.com/mattn/anko/ast/util
github.com/mattn/anko/builtins
github.com/mattn/anko/builtins/encoding/json
github.com/mattn/anko/builtins/errors
github.com/mattn/anko/builtins/flag
github.com/mattn/anko/builtins/fmt
github.com/mattn/anko/builtins/github.com/daviddengcn/go-colortext
github.com/mattn/anko/builtins/io
github.com/mattn/anko/builtins/io/ioutil
github.com/mattn/anko/builtins/math
github.com/mattn/anko/builtins/math/big
github.com/mattn/anko/builtins/math/rand
github.com/mattn/anko/builtins/net
github.com/mattn/anko/builtins/net/http
github.com/mattn/anko/builtins/net/url
github.com/mattn/anko/builtins/os
github.com/mattn/anko/builtins/os/exec
github.com/mattn/anko/builtins/os/signal
github.com/mattn/anko/builtins/path
github.com/mattn/anko/builtins/path/filepath
github.com/mattn/anko/builtins/regexp
github.com/mattn/anko/builtins/runtime
github.com/mattn/anko/builtins/sort
github.com/mattn/anko/builtins/strconv
github.com/mattn/anko/builtins/strings
github.com/mattn/anko/builtins/time
github.com/mattn/anko/parser
github.com/mattn/anko/tool
github.com/mattn/anko/vm
github.com/mattn/go-adodb
github.com/mattn/go-colorable
github.com/mattn/go-colorable/cmd/colorable
github.com/mattn/go-isatty
github.com/mattn/go-oci8
github.com/mattn/go-runewidth
github.com/mattn/go-shellwords
github.com/mattn/go-sqlite3
github.com/mattn/go-tty
github.com/mattn/go-tty/example
github.com/mattn/go-tty/readline
github.com/mattn/go-zglob
github.com/mattn/go-zglob/cmd/zglob
github.com/mattn/go-zglob/fastwalk
github.com/matttproud/golang_protobuf_extensions/ext
github.com/matttproud/golang_protobuf_extensions/pbtest
github.com/matttproud/golang_protobuf_extensions/pbutil
github.com/mehrdadrad/mylg
github.com/mehrdadrad/mylg/banner
github.com/mehrdadrad/mylg/cli
github.com/mehrdadrad/mylg/data
github.com/mehrdadrad/mylg/disc
github.com/mehrdadrad/mylg/http/ping
github.com/mehrdadrad/mylg/icmp
github.com/mehrdadrad/mylg/lg
github.com/mehrdadrad/mylg/nms
github.com/mehrdadrad/mylg/ns
github.com/mehrdadrad/mylg/packet
github.com/mehrdadrad/mylg/peeringdb
github.com/mehrdadrad/mylg/ripe
github.com/mehrdadrad/mylg/scan
github.com/mehrdadrad/mylg/services/dashboard/statik
github.com/mehrdadrad/mylg/services/httpd
github.com/mehrdadrad/mylg/speedtest
github.com/mehrdadrad/mylg/ssh
github.com/mehrdadrad/mylg/whois
github.com/metaleap/go-buildrun
github.com/metaleap/go-util
github.com/metaleap/go-util/3d
github.com/metaleap/go-util/db
github.com/metaleap/go-util/db/umgo
github.com/metaleap/go-util/dev
github.com/metaleap/go-util/dev/bower
github.com/metaleap/go-util/dev/go
github.com/metaleap/go-util/dev/hs
github.com/metaleap/go-util/dev/ps
github.com/metaleap/go-util/fs
github.com/metaleap/go-util/geo
github.com/metaleap/go-util/gfx
github.com/metaleap/go-util/hash
github.com/metaleap/go-util/net
github.com/metaleap/go-util/num
github.com/metaleap/go-util/run
github.com/metaleap/go-util/slice
github.com/metaleap/go-util/str
github.com/metaleap/go-util/sys
github.com/metaleap/go-util-fs
github.com/metaleap/go-util-misc
github.com/metaleap/go-util-net
github.com/metaleap/go-util-slice
github.com/metaleap/go-util-str
github.com/metaleap/go-xsd
github.com/metaleap/go-xsd/types
github.com/metaleap/go-xsd/xsd-makepkg
github.com/metaleap/go-xsd/xsd-makepkg/tests
github.com/metaleap/go-xsd/xsd-makepkg/tests/xsd-test-atom
github.com/metaleap/go-xsd/xsd-makepkg/tests/xsd-test-collada
github.com/metaleap/go-xsd/xsd-makepkg/tests/xsd-test-kml
github.com/metaleap/go-xsd/xsd-makepkg/tests/xsd-test-rss
github.com/metaleap/go-xsd/xsd-makepkg/tests/xsd-test-svg
github.com/metaleap/go-xsd-pkg/docbook.org/xml/5.0/xsd/docbook.xsd_go
github.com/metaleap/go-xsd-pkg/docbook.org/xml/5.0/xsd/xlink.xsd_go
github.com/metaleap/go-xsd-pkg/docbook.org/xml/5.0/xsd/xml.xsd_go
github.com/metaleap/go-xsd-pkg/docs.oasis-open.org/election/external/xAL.xsd_go
github.com/metaleap/go-xsd-pkg/kbcafe.com/rss/atom.xsd.xml_go
github.com/metaleap/go-xsd-pkg/khronos.org/files/collada_schema_1_4_go
github.com/metaleap/go-xsd-pkg/khronos.org/files/collada_schema_1_5_go
github.com/metaleap/go-xsd-pkg/schemas.opengis.net/kml/2.2.0/atom-author-link.xsd_go
github.com/metaleap/go-xsd-pkg/schemas.opengis.net/kml/2.2.0/ogckml22.xsd_go
github.com/metaleap/go-xsd-pkg/thearchitect.co.uk/schemas/rss-2_0.xsd_go
github.com/metaleap/go-xsd-pkg/www.w3.org/2001/03/xml.xsd_go
github.com/metaleap/go-xsd-pkg/www.w3.org/2001/xml.xsd_go
github.com/metaleap/go-xsd-pkg/www.w3.org/2007/schema-for-xslt20.xsd_go
github.com/metaleap/go-xsd-pkg/www.w3.org/Math/XMLSchema/mathml2/common/xlink-href.xsd_go
github.com/metaleap/go-xsd-pkg/www.w3.org/Math/XMLSchema/mathml2/mathml2.xsd_go
github.com/metaleap/go-xsd-pkg/www.w3.org/TR/2002/WD-SVG11-20020108/SVG.xsd_go
github.com/metaleap/go-xsd-pkg/www.w3.org/TR/2002/WD-SVG11-20020108/xlink.xsd_go
github.com/metaleap/go-xsd-pkg/www.w3.org/TR/2002/WD-SVG11-20020108/xml.xsd_go
github.com/mfonda/simhash
github.com/mgutz/ansi
github.com/mgutz/ansi/cmd/ansi-mgutz
github.com/mgutz/logxi/Gododir
github.com/mgutz/logxi/v1
github.com/mgutz/logxi/v1/bench
github.com/mgutz/logxi/v1/cmd/demo
github.com/mgutz/logxi/v1/cmd/filter
github.com/mgutz/logxi/v1/cmd/reldir
github.com/mholt/archiver
github.com/mholt/archiver/cmd/archiver
github.com/mholt/caddy
github.com/mholt/caddy/caddy
github.com/mholt/caddy/caddy/caddymain
github.com/mholt/caddy/caddyfile
github.com/mholt/caddy/caddyhttp
github.com/mholt/caddy/caddyhttp/basicauth
github.com/mholt/caddy/caddyhttp/bind
github.com/mholt/caddy/caddyhttp/browse
github.com/mholt/caddy/caddyhttp/errors
github.com/mholt/caddy/caddyhttp/expvar
github.com/mholt/caddy/caddyhttp/extensions
github.com/mholt/caddy/caddyhttp/fastcgi
github.com/mholt/caddy/caddyhttp/gzip
github.com/mholt/caddy/caddyhttp/header
github.com/mholt/caddy/caddyhttp/httpserver
github.com/mholt/caddy/caddyhttp/index
github.com/mholt/caddy/caddyhttp/internalsrv
github.com/mholt/caddy/caddyhttp/limits
github.com/mholt/caddy/caddyhttp/log
github.com/mholt/caddy/caddyhttp/markdown
github.com/mholt/caddy/caddyhttp/markdown/metadata
github.com/mholt/caddy/caddyhttp/markdown/summary
github.com/mholt/caddy/caddyhttp/mime
github.com/mholt/caddy/caddyhttp/pprof
github.com/mholt/caddy/caddyhttp/proxy
github.com/mholt/caddy/caddyhttp/push
github.com/mholt/caddy/caddyhttp/redirect
github.com/mholt/caddy/caddyhttp/requestid
github.com/mholt/caddy/caddyhttp/rewrite
github.com/mholt/caddy/caddyhttp/root
github.com/mholt/caddy/caddyhttp/staticfiles
github.com/mholt/caddy/caddyhttp/status
github.com/mholt/caddy/caddyhttp/templates
github.com/mholt/caddy/caddyhttp/timeouts
github.com/mholt/caddy/caddyhttp/websocket
github.com/mholt/caddy/caddytls
github.com/mholt/caddy/caddytls/storagetest
github.com/mholt/caddy/onevent
github.com/mholt/caddy/onevent/hook
github.com/mholt/caddy/startupshutdown
github.com/microcosm-cc/bluemonday
github.com/microcosm-cc/bluemonday/cmd/sanitise_html_email
github.com/microcosm-cc/bluemonday/cmd/sanitise_ugc
github.com/miekg/dns
github.com/miekg/dns/dnsutil
github.com/miekg/mmark
github.com/miekg/mmark/mmark
github.com/minio/blake2b-simd
github.com/mitchellh/go-homedir
github.com/mitchellh/go-wordwrap
github.com/mitchellh/gox
github.com/mitchellh/iochan
github.com/mitchellh/mapstructure
github.com/mitchellh/packer
github.com/mitchellh/packer/builder/alicloud/ecs
github.com/mitchellh/packer/builder/amazon/chroot
github.com/mitchellh/packer/builder/amazon/common
github.com/mitchellh/packer/builder/amazon/ebs
github.com/mitchellh/packer/builder/amazon/ebssurrogate
github.com/mitchellh/packer/builder/amazon/ebsvolume
github.com/mitchellh/packer/builder/amazon/instance
github.com/mitchellh/packer/builder/azure/arm
github.com/mitchellh/packer/builder/azure/common
github.com/mitchellh/packer/builder/azure/common/constants
github.com/mitchellh/packer/builder/azure/common/lin
github.com/mitchellh/packer/builder/azure/common/logutil
github.com/mitchellh/packer/builder/azure/common/template
github.com/mitchellh/packer/builder/azure/pkcs12
github.com/mitchellh/packer/builder/azure/pkcs12/rc2
github.com/mitchellh/packer/builder/cloudstack
github.com/mitchellh/packer/builder/digitalocean
github.com/mitchellh/packer/builder/docker
github.com/mitchellh/packer/builder/file
github.com/mitchellh/packer/builder/googlecompute
github.com/mitchellh/packer/builder/hyperv/common
github.com/mitchellh/packer/builder/hyperv/iso
github.com/mitchellh/packer/builder/hyperv/vmcx
github.com/mitchellh/packer/builder/lxc
github.com/mitchellh/packer/builder/lxd
github.com/mitchellh/packer/builder/null
github.com/mitchellh/packer/builder/oneandone
github.com/mitchellh/packer/builder/openstack
github.com/mitchellh/packer/builder/oracle/oci
github.com/mitchellh/packer/builder/oracle/oci/client
github.com/mitchellh/packer/builder/parallels/common
github.com/mitchellh/packer/builder/parallels/iso
github.com/mitchellh/packer/builder/parallels/pvm
github.com/mitchellh/packer/builder/profitbricks
github.com/mitchellh/packer/builder/qemu
github.com/mitchellh/packer/builder/triton
github.com/mitchellh/packer/builder/virtualbox/common
github.com/mitchellh/packer/builder/virtualbox/iso
github.com/mitchellh/packer/builder/virtualbox/ovf
github.com/mitchellh/packer/builder/vmware/common
github.com/mitchellh/packer/builder/vmware/iso
github.com/mitchellh/packer/builder/vmware/vmx
github.com/mitchellh/packer/command
github.com/mitchellh/packer/common
github.com/mitchellh/packer/common/json
github.com/mitchellh/packer/common/powershell
github.com/mitchellh/packer/common/powershell/hyperv
github.com/mitchellh/packer/common/ssh
github.com/mitchellh/packer/common/uuid
github.com/mitchellh/packer/communicator/none
github.com/mitchellh/packer/communicator/ssh
github.com/mitchellh/packer/communicator/winrm
github.com/mitchellh/packer/fix
github.com/mitchellh/packer/helper/builder/testing
github.com/mitchellh/packer/helper/communicator
github.com/mitchellh/packer/helper/config
github.com/mitchellh/packer/helper/enumflag
github.com/mitchellh/packer/helper/flag-kv
github.com/mitchellh/packer/helper/flag-slice
github.com/mitchellh/packer/packer
github.com/mitchellh/packer/packer/plugin
github.com/mitchellh/packer/packer/rpc
github.com/mitchellh/packer/plugin/example
github.com/mitchellh/packer/post-processor/alicloud-import
github.com/mitchellh/packer/post-processor/amazon-import
github.com/mitchellh/packer/post-processor/artifice
github.com/mitchellh/packer/post-processor/atlas
github.com/mitchellh/packer/post-processor/checksum
github.com/mitchellh/packer/post-processor/compress
github.com/mitchellh/packer/post-processor/docker-import
github.com/mitchellh/packer/post-processor/docker-push
github.com/mitchellh/packer/post-processor/docker-save
github.com/mitchellh/packer/post-processor/docker-tag
github.com/mitchellh/packer/post-processor/googlecompute-export
github.com/mitchellh/packer/post-processor/manifest
github.com/mitchellh/packer/post-processor/shell-local
github.com/mitchellh/packer/post-processor/vagrant
github.com/mitchellh/packer/post-processor/vagrant-cloud
github.com/mitchellh/packer/post-processor/vsphere
github.com/mitchellh/packer/post-processor/vsphere-template
github.com/mitchellh/packer/provisioner
github.com/mitchellh/packer/provisioner/ansible
github.com/mitchellh/packer/provisioner/ansible-local
github.com/mitchellh/packer/provisioner/chef-client
github.com/mitchellh/packer/provisioner/chef-solo
github.com/mitchellh/packer/provisioner/converge
github.com/mitchellh/packer/provisioner/file
github.com/mitchellh/packer/provisioner/powershell
github.com/mitchellh/packer/provisioner/puppet-masterless
github.com/mitchellh/packer/provisioner/puppet-server
github.com/mitchellh/packer/provisioner/salt-masterless
github.com/mitchellh/packer/provisioner/shell
github.com/mitchellh/packer/provisioner/shell-local
github.com/mitchellh/packer/provisioner/windows-restart
github.com/mitchellh/packer/provisioner/windows-shell
github.com/mitchellh/packer/scripts
github.com/mitchellh/packer/template
github.com/mitchellh/packer/template/interpolate
github.com/mitchellh/packer/version
github.com/mkchoi212/fac
github.com/mkchoi212/fac/color
github.com/mkchoi212/fac/conflict
github.com/moby/moby/api
github.com/moby/moby/api/server
github.com/moby/moby/api/server/backend/build
github.com/moby/moby/api/server/httputils
github.com/moby/moby/api/server/middleware
github.com/moby/moby/api/server/router
github.com/moby/moby/api/server/router/build
github.com/moby/moby/api/server/router/checkpoint
github.com/moby/moby/api/server/router/container
github.com/moby/moby/api/server/router/debug
github.com/moby/moby/api/server/router/distribution
github.com/moby/moby/api/server/router/image
github.com/moby/moby/api/server/router/network
github.com/moby/moby/api/server/router/plugin
github.com/moby/moby/api/server/router/session
github.com/moby/moby/api/server/router/swarm
github.com/moby/moby/api/server/router/system
github.com/moby/moby/api/server/router/volume
github.com/moby/moby/api/types
github.com/moby/moby/api/types/backend
github.com/moby/moby/api/types/blkiodev
github.com/moby/moby/api/types/container
github.com/moby/moby/api/types/events
github.com/moby/moby/api/types/filters
github.com/moby/moby/api/types/image
github.com/moby/moby/api/types/mount
github.com/moby/moby/api/types/network
github.com/moby/moby/api/types/plugins/logdriver
github.com/moby/moby/api/types/registry
github.com/moby/moby/api/types/strslice
github.com/moby/moby/api/types/swarm
github.com/moby/moby/api/types/swarm/runtime
github.com/moby/moby/api/types/time
github.com/moby/moby/api/types/versions
github.com/moby/moby/api/types/versions/v1p19
github.com/moby/moby/api/types/versions/v1p20
github.com/moby/moby/api/types/volume
github.com/moby/moby/builder
github.com/moby/moby/builder/dockerfile
github.com/moby/moby/builder/dockerfile/command
github.com/moby/moby/builder/dockerfile/instructions
github.com/moby/moby/builder/dockerfile/parser
github.com/moby/moby/builder/dockerfile/parser/dumper
github.com/moby/moby/builder/dockerignore
github.com/moby/moby/builder/fscache
github.com/moby/moby/builder/remotecontext
github.com/moby/moby/builder/remotecontext/git
github.com/moby/moby/cli
github.com/moby/moby/cli/config
github.com/moby/moby/cli/debug
github.com/moby/moby/client
github.com/moby/moby/cmd/dockerd
github.com/moby/moby/cmd/dockerd/hack
github.com/moby/moby/container
github.com/moby/moby/container/stream
github.com/moby/moby/contrib/apparmor
github.com/moby/moby/contrib/docker-device-tool
github.com/moby/moby/contrib/httpserver
github.com/moby/moby/daemon
github.com/moby/moby/daemon/caps
github.com/moby/moby/daemon/cluster
github.com/moby/moby/daemon/cluster/controllers/plugin
github.com/moby/moby/daemon/cluster/convert
github.com/moby/moby/daemon/cluster/executor
github.com/moby/moby/daemon/cluster/executor/container
github.com/moby/moby/daemon/cluster/provider
github.com/moby/moby/daemon/config
github.com/moby/moby/daemon/discovery
github.com/moby/moby/daemon/events
github.com/moby/moby/daemon/events/testutils
github.com/moby/moby/daemon/exec
github.com/moby/moby/daemon/graphdriver
github.com/moby/moby/daemon/graphdriver/aufs
github.com/moby/moby/daemon/graphdriver/btrfs
github.com/moby/moby/daemon/graphdriver/copy
github.com/moby/moby/daemon/graphdriver/devmapper
github.com/moby/moby/daemon/graphdriver/graphtest
github.com/moby/moby/daemon/graphdriver/overlay
github.com/moby/moby/daemon/graphdriver/overlay2
github.com/moby/moby/daemon/graphdriver/overlayutils
github.com/moby/moby/daemon/graphdriver/quota
github.com/moby/moby/daemon/graphdriver/register
github.com/moby/moby/daemon/graphdriver/vfs
github.com/moby/moby/daemon/graphdriver/zfs
github.com/moby/moby/daemon/initlayer
github.com/moby/moby/daemon/links
github.com/moby/moby/daemon/listeners
github.com/moby/moby/daemon/logger
github.com/moby/moby/daemon/logger/awslogs
github.com/moby/moby/daemon/logger/fluentd
github.com/moby/moby/daemon/logger/gcplogs
github.com/moby/moby/daemon/logger/gelf
github.com/moby/moby/daemon/logger/journald
github.com/moby/moby/daemon/logger/jsonfilelog
github.com/moby/moby/daemon/logger/jsonfilelog/jsonlog
github.com/moby/moby/daemon/logger/logentries
github.com/moby/moby/daemon/logger/loggerutils
github.com/moby/moby/daemon/logger/loggerutils/multireader
github.com/moby/moby/daemon/logger/splunk
github.com/moby/moby/daemon/logger/syslog
github.com/moby/moby/daemon/logger/templates
github.com/moby/moby/daemon/names
github.com/moby/moby/daemon/network
github.com/moby/moby/daemon/stats
github.com/moby/moby/distribution
github.com/moby/moby/distribution/metadata
github.com/moby/moby/distribution/utils
github.com/moby/moby/distribution/xfer
github.com/moby/moby/dockerversion
github.com/moby/moby/errdefs
github.com/moby/moby/hack/integration-cli-on-swarm/agent/master
github.com/moby/moby/hack/integration-cli-on-swarm/agent/types
github.com/moby/moby/hack/integration-cli-on-swarm/agent/worker
github.com/moby/moby/hack/integration-cli-on-swarm/host
github.com/moby/moby/image
github.com/moby/moby/image/cache
github.com/moby/moby/image/tarexport
github.com/moby/moby/image/v1
github.com/moby/moby/integration
github.com/moby/moby/integration/build
github.com/moby/moby/integration/container
github.com/moby/moby/integration/image
github.com/moby/moby/integration/network
github.com/moby/moby/integration/plugin
github.com/moby/moby/integration/plugin/authz
github.com/moby/moby/integration/service
github.com/moby/moby/integration/system
github.com/moby/moby/integration/util/request
github.com/moby/moby/integration/util/requirement
github.com/moby/moby/integration-cli
github.com/moby/moby/integration-cli/checker
github.com/moby/moby/integration-cli/cli
github.com/moby/moby/integration-cli/cli/build
github.com/moby/moby/integration-cli/cli/build/fakecontext
github.com/moby/moby/integration-cli/cli/build/fakegit
github.com/moby/moby/integration-cli/cli/build/fakestorage
github.com/moby/moby/integration-cli/daemon
github.com/moby/moby/integration-cli/environment
github.com/moby/moby/integration-cli/fixtures/load
github.com/moby/moby/integration-cli/fixtures/plugin
github.com/moby/moby/integration-cli/fixtures/plugin/basic
github.com/moby/moby/integration-cli/registry
github.com/moby/moby/integration-cli/request
github.com/moby/moby/integration-cli/requirement
github.com/moby/moby/internal/test/environment
github.com/moby/moby/internal/testutil
github.com/moby/moby/layer
github.com/moby/moby/libcontainerd
github.com/moby/moby/migrate/v1
github.com/moby/moby/oci
github.com/moby/moby/opts
github.com/moby/moby/pkg/aaparser
github.com/moby/moby/pkg/archive
github.com/moby/moby/pkg/authorization
github.com/moby/moby/pkg/broadcaster
github.com/moby/moby/pkg/chrootarchive
github.com/moby/moby/pkg/containerfs
github.com/moby/moby/pkg/devicemapper
github.com/moby/moby/pkg/directory
github.com/moby/moby/pkg/discovery
github.com/moby/moby/pkg/discovery/file
github.com/moby/moby/pkg/discovery/kv
github.com/moby/moby/pkg/discovery/memory
github.com/moby/moby/pkg/discovery/nodes
github.com/moby/moby/pkg/dmesg
github.com/moby/moby/pkg/filenotify
github.com/moby/moby/pkg/fileutils
github.com/moby/moby/pkg/fsutils
github.com/moby/moby/pkg/homedir
github.com/moby/moby/pkg/idtools
github.com/moby/moby/pkg/ioutils
github.com/moby/moby/pkg/jsonmessage
github.com/moby/moby/pkg/locker
github.com/moby/moby/pkg/longpath
github.com/moby/moby/pkg/loopback
github.com/moby/moby/pkg/mount
github.com/moby/moby/pkg/namesgenerator
github.com/moby/moby/pkg/namesgenerator/cmd/names-generator
github.com/moby/moby/pkg/parsers
github.com/moby/moby/pkg/parsers/kernel
github.com/moby/moby/pkg/parsers/operatingsystem
github.com/moby/moby/pkg/pidfile
github.com/moby/moby/pkg/platform
github.com/moby/moby/pkg/plugingetter
github.com/moby/moby/pkg/plugins
github.com/moby/moby/pkg/plugins/pluginrpc-gen
github.com/moby/moby/pkg/plugins/pluginrpc-gen/fixtures
github.com/moby/moby/pkg/plugins/pluginrpc-gen/fixtures/otherfixture
github.com/moby/moby/pkg/plugins/transport
github.com/moby/moby/pkg/pools
github.com/moby/moby/pkg/progress
github.com/moby/moby/pkg/pubsub
github.com/moby/moby/pkg/reexec
github.com/moby/moby/pkg/signal
github.com/moby/moby/pkg/signal/testfiles
github.com/moby/moby/pkg/stdcopy
github.com/moby/moby/pkg/streamformatter
github.com/moby/moby/pkg/stringid
github.com/moby/moby/pkg/symlink
github.com/moby/moby/pkg/sysinfo
github.com/moby/moby/pkg/system
github.com/moby/moby/pkg/tailfile
github.com/moby/moby/pkg/tarsum
github.com/moby/moby/pkg/term
github.com/moby/moby/pkg/term/windows
github.com/moby/moby/pkg/truncindex
github.com/moby/moby/pkg/urlutil
github.com/moby/moby/pkg/useragent
github.com/moby/moby/plugin
github.com/moby/moby/plugin/executor/containerd
github.com/moby/moby/plugin/v2
github.com/moby/moby/profiles/apparmor
github.com/moby/moby/profiles/seccomp
github.com/moby/moby/reference
github.com/moby/moby/registry
github.com/moby/moby/registry/resumable
github.com/moby/moby/restartmanager
github.com/moby/moby/runconfig
github.com/moby/moby/runconfig/opts
github.com/moby/moby/volume
github.com/moby/moby/volume/drivers
github.com/moby/moby/volume/local
github.com/moby/moby/volume/store
github.com/moby/moby/volume/testutils
github.com/monoculum/formam
github.com/motemen/go-quickfix
github.com/motemen/go-quickfix/cmd/goquickfix
github.com/motemen/gore
github.com/motemen/gore/gocode
github.com/moul/http2curl
github.com/nakagami/firebirdsql
github.com/naoina/go-stringutil
github.com/naoina/toml
github.com/naoina/toml/ast
github.com/nats-io/go-nats
github.com/nats-io/go-nats/bench
github.com/nats-io/go-nats/encoders/builtin
github.com/nats-io/go-nats/encoders/protobuf
github.com/nats-io/go-nats/examples
github.com/nats-io/go-nats/test
github.com/nats-io/go-nats/util
github.com/nats-io/nats
github.com/nats-io/nats/bench
github.com/nats-io/nats/encoders/builtin
github.com/nats-io/nats/encoders/protobuf
github.com/nats-io/nats/examples
github.com/nats-io/nats/test
github.com/nats-io/nats/util
github.com/nats-io/nuid
github.com/neelance/parallel
github.com/neelance/sourcemap
github.com/newhook/go-symbols
github.com/newrelic/go-agent
github.com/newrelic/go-agent/examples/server
github.com/newrelic/go-agent/examples/short-lived-process
github.com/newrelic/go-agent/internal
github.com/newrelic/go-agent/internal/cat
github.com/newrelic/go-agent/internal/crossagent
github.com/newrelic/go-agent/internal/jsonx
github.com/newrelic/go-agent/internal/logger
github.com/newrelic/go-agent/internal/sysinfo
github.com/newrelic/go-agent/internal/tools/rules
github.com/newrelic/go-agent/internal/tools/utilization
github.com/newrelic/go-agent/internal/utilization
github.com/nfnt/resize
github.com/nicksnyder/go-i18n/goi18n
github.com/nicksnyder/go-i18n/i18n
github.com/nicksnyder/go-i18n/i18n/bundle
github.com/nicksnyder/go-i18n/i18n/language
github.com/nicksnyder/go-i18n/i18n/language/codegen
github.com/nicksnyder/go-i18n/i18n/translation
github.com/nlopes/slack
github.com/nlopes/slack/examples/channels
github.com/nlopes/slack/examples/files
github.com/nlopes/slack/examples/groups
github.com/nlopes/slack/examples/ims
github.com/nlopes/slack/examples/messages
github.com/nlopes/slack/examples/pins
github.com/nlopes/slack/examples/reactions
github.com/nlopes/slack/examples/stars
github.com/nlopes/slack/examples/team
github.com/nlopes/slack/examples/users
github.com/nlopes/slack/examples/websocket
github.com/nsf/gocode
github.com/nsf/termbox-go
github.com/nu7hatch/gouuid
github.com/nwaples/rardecode
github.com/nwidger/jsoncolor
github.com/nyarla/go-crypt
github.com/oleiade/reflections
github.com/olekukonko/tablewriter
github.com/olekukonko/tablewriter/csv2table
github.com/onsi/ginkgo
github.com/onsi/ginkgo/config
github.com/onsi/ginkgo/extensions/table
github.com/onsi/ginkgo/ginkgo
github.com/onsi/ginkgo/ginkgo/convert
github.com/onsi/ginkgo/ginkgo/interrupthandler
github.com/onsi/ginkgo/ginkgo/nodot
github.com/onsi/ginkgo/ginkgo/testrunner
github.com/onsi/ginkgo/ginkgo/testsuite
github.com/onsi/ginkgo/ginkgo/watch
github.com/onsi/ginkgo/integration
github.com/onsi/ginkgo/internal/codelocation
github.com/onsi/ginkgo/internal/containernode
github.com/onsi/ginkgo/internal/failer
github.com/onsi/ginkgo/internal/leafnodes
github.com/onsi/ginkgo/internal/remote
github.com/onsi/ginkgo/internal/spec
github.com/onsi/ginkgo/internal/spec_iterator
github.com/onsi/ginkgo/internal/specrunner
github.com/onsi/ginkgo/internal/suite
github.com/onsi/ginkgo/internal/testingtproxy
github.com/onsi/ginkgo/internal/writer
github.com/onsi/ginkgo/reporters
github.com/onsi/ginkgo/reporters/stenographer
github.com/onsi/ginkgo/reporters/stenographer/support/go-colorable
github.com/onsi/ginkgo/reporters/stenographer/support/go-isatty
github.com/onsi/ginkgo/types
github.com/onsi/gomega
github.com/onsi/gomega/format
github.com/onsi/gomega/gbytes
github.com/onsi/gomega/gexec
github.com/onsi/gomega/ghttp
github.com/onsi/gomega/ghttp/protobuf
github.com/onsi/gomega/gstruct
github.com/onsi/gomega/gstruct/errors
github.com/onsi/gomega/internal/assertion
github.com/onsi/gomega/internal/asyncassertion
github.com/onsi/gomega/internal/fakematcher
github.com/onsi/gomega/internal/oraclematcher
github.com/onsi/gomega/internal/testingtsupport
github.com/onsi/gomega/matchers
github.com/onsi/gomega/matchers/support/goraph/bipartitegraph
github.com/onsi/gomega/matchers/support/goraph/edge
github.com/onsi/gomega/matchers/support/goraph/node
github.com/onsi/gomega/matchers/support/goraph/util
github.com/onsi/gomega/types
github.com/opencontainers/runtime-spec/schema
github.com/opencontainers/runtime-spec/specs-go
github.com/opentracing/basictracer-go
github.com/opentracing/basictracer-go/events
github.com/opentracing/basictracer-go/examples
github.com/opentracing/basictracer-go/examples/dapperish
github.com/opentracing/basictracer-go/wire
github.com/opentracing/opentracing-go
github.com/opentracing/opentracing-go/ext
github.com/opentracing/opentracing-go/log
github.com/opentracing/opentracing-go/mocktracer
github.com/oracle/smith
github.com/oracle/smith/execute
github.com/ory-am/common/broker
github.com/ory-am/common/compiler
github.com/ory-am/common/connectdb
github.com/ory-am/common/env
github.com/ory-am/common/integration
github.com/ory-am/common/path
github.com/ory-am/common/pkg
github.com/ory-am/common/rand
github.com/ory-am/common/rand/numeric
github.com/ory-am/common/rand/sequence
github.com/ory-am/ladon
github.com/ory-am/ladon/compiler
github.com/ory-am/ladon/integration
github.com/ory-am/ladon/manager/memory
github.com/ory-am/ladon/manager/sql
github.com/parnurzeal/gorequest
github.com/peco/peco
github.com/peco/peco/cmd/peco
github.com/peco/peco/filter
github.com/peco/peco/hub
github.com/peco/peco/internal/buffer
github.com/peco/peco/internal/keyseq
github.com/peco/peco/internal/util
github.com/peco/peco/line
github.com/peco/peco/pipeline
github.com/peco/peco/sig
github.com/pelletier/go-buffruneio
github.com/pelletier/go-toml
github.com/pelletier/go-toml/cmd
github.com/pelletier/go-toml/cmd/tomljson
github.com/pelletier/go-toml/cmd/tomll
github.com/pelletier/go-toml/query
github.com/peterbourgon/diskv
github.com/peterbourgon/diskv/examples/content-addressable-store
github.com/peterbourgon/diskv/examples/super-simple-store
github.com/peterh/liner
github.com/philhofer/fwd
github.com/pierrec/lz4
github.com/pierrec/lz4/fuzz
github.com/pierrec/lz4/lz4c
github.com/pierrec/xxHash/xxHash32
github.com/pierrec/xxHash/xxHash64
github.com/pierrec/xxHash/xxhsum
github.com/pkg/errors
github.com/pkg/sftp
github.com/pkg/sftp/examples/buffered-read-benchmark
github.com/pkg/sftp/examples/buffered-write-benchmark
github.com/pkg/sftp/examples/request-server
github.com/pkg/sftp/examples/sftp-server
github.com/pkg/sftp/examples/streaming-read-benchmark
github.com/pkg/sftp/examples/streaming-write-benchmark
github.com/pkg/sftp/server_standalone
github.com/pltanton/yags
github.com/pltanton/yags/core
github.com/pltanton/yags/plugins
github.com/pltanton/yags/plugins/suspend
github.com/pltanton/yags/utils
github.com/posener/complete
github.com/posener/complete/cmd
github.com/posener/complete/cmd/install
github.com/posener/complete/example/self
github.com/posener/complete/gocomplete
github.com/posener/complete/match
github.com/pressly/chi
github.com/pressly/chi/middleware
github.com/prestodb/presto-go-client/presto
github.com/prometheus/client_golang/api
github.com/prometheus/client_golang/api/prometheus/v1
github.com/prometheus/client_golang/examples/random
github.com/prometheus/client_golang/examples/simple
github.com/prometheus/client_golang/prometheus
github.com/prometheus/client_golang/prometheus/graphite
github.com/prometheus/client_golang/prometheus/promhttp
github.com/prometheus/client_golang/prometheus/push
github.com/prometheus/client_model/go
github.com/prometheus/common/config
github.com/prometheus/common/expfmt
github.com/prometheus/common/internal/bitbucket.org/ww/goautoneg
github.com/prometheus/common/log
github.com/prometheus/common/model
github.com/prometheus/common/promlog
github.com/prometheus/common/promlog/flag
github.com/prometheus/common/route
github.com/prometheus/common/version
github.com/prometheus/procfs
github.com/prometheus/procfs/bcache
github.com/prometheus/procfs/sysfs
github.com/prometheus/procfs/xfs
github.com/rakyll/statik
github.com/rakyll/statik/example
github.com/rakyll/statik/example/statik
github.com/rakyll/statik/fs
github.com/ramya-rao-a/go-outline
github.com/rana/ora/date
github.com/rana/ora/examples/bench
github.com/rana/ora/examples/bench/oci8
github.com/rana/ora/examples/bench/ora
github.com/rana/ora/examples/connect
github.com/rana/ora/examples/conntest
github.com/rana/ora/examples/csvdump
github.com/rana/ora/examples/csvload
github.com/rana/ora/glg
github.com/rana/ora/lg
github.com/rana/ora/lg15
github.com/rana/ora/num
github.com/rana/ora/tstlg
github.com/reconquest/barely
github.com/reconquest/loreley
github.com/reiver/go-oi
github.com/reiver/go-oi/test
github.com/reiver/go-telnet
github.com/reiver/go-telnet/telsh
github.com/rgburke/goncurses
github.com/rgburke/goncurses/examples/acs
github.com/rgburke/goncurses/examples/border
github.com/rgburke/goncurses/examples/color
github.com/rgburke/goncurses/examples/concurrency
github.com/rgburke/goncurses/examples/curs_menu
github.com/rgburke/goncurses/examples/features
github.com/rgburke/goncurses/examples/form
github.com/rgburke/goncurses/examples/getstr
github.com/rgburke/goncurses/examples/hello
github.com/rgburke/goncurses/examples/init
github.com/rgburke/goncurses/examples/menu
github.com/rgburke/goncurses/examples/menu_mcol
github.com/rgburke/goncurses/examples/menu_scroll
github.com/rgburke/goncurses/examples/menu_subwin
github.com/rgburke/goncurses/examples/menugrey
github.com/rgburke/goncurses/examples/menutoggle
github.com/rgburke/goncurses/examples/mouse
github.com/rgburke/goncurses/examples/newterm
github.com/rgburke/goncurses/examples/pad
github.com/rgburke/goncurses/examples/panel
github.com/rgburke/goncurses/examples/panel2
github.com/rgburke/goncurses/examples/print
github.com/rgburke/goncurses/examples/slk
github.com/rgburke/goncurses/examples/starfield
github.com/rgburke/goncurses/examples/window
github.com/rgburke/grv/cmd/grv
github.com/rifflock/lfshook
github.com/rjeczalik/notify
github.com/robphoenix/trawl
github.com/rogpeppe/godef
github.com/rogpeppe/godef/go/ast
github.com/rogpeppe/godef/go/parser
github.com/rogpeppe/godef/go/printer
github.com/rogpeppe/godef/go/scanner
github.com/rogpeppe/godef/go/sym
github.com/rogpeppe/godef/go/token
github.com/rogpeppe/godef/go/types
github.com/rubenv/sql-migrate
github.com/rubenv/sql-migrate/sql-migrate
github.com/rubenv/sql-migrate/sqlparse
github.com/russross/blackfriday
github.com/satori/go.uuid
github.com/satori/uuid
github.com/segmentio/go-env
github.com/segmentio/ksuid
github.com/segmentio/ksuid/cmd/ksuid
github.com/serenize/snaker
github.com/sergi/go-diff/diffmatchpatch
github.com/sethgrid/pester
github.com/sethgrid/pester/benchmarks
github.com/sethgrid/pester/sample
github.com/shurcooL/Go-Package-Store
github.com/shurcooL/Go-Package-Store/assets
github.com/shurcooL/Go-Package-Store/cmd/Go-Package-Store
github.com/shurcooL/Go-Package-Store/component
github.com/shurcooL/Go-Package-Store/frontend
github.com/shurcooL/Go-Package-Store/frontend/action
github.com/shurcooL/Go-Package-Store/frontend/model
github.com/shurcooL/Go-Package-Store/frontend/store
github.com/shurcooL/Go-Package-Store/presenter
github.com/shurcooL/Go-Package-Store/presenter/github
github.com/shurcooL/Go-Package-Store/presenter/gitiles
github.com/shurcooL/Go-Package-Store/updater
github.com/shurcooL/Go-Package-Store/workspace
github.com/shurcooL/binstale
github.com/shurcooL/github_flavored_markdown
github.com/shurcooL/github_flavored_markdown/gfmstyle
github.com/shurcooL/go/browser
github.com/shurcooL/go/ctxhttp
github.com/shurcooL/go/gddo
github.com/shurcooL/go/generated
github.com/shurcooL/go/gfmutil
github.com/shurcooL/go/gopathutil
github.com/shurcooL/go/gopherjs_http
github.com/shurcooL/go/gopherjs_http/jsutil
github.com/shurcooL/go/importgraphutil
github.com/shurcooL/go/indentwriter
github.com/shurcooL/go/ioutil
github.com/shurcooL/go/open
github.com/shurcooL/go/openutil
github.com/shurcooL/go/ospath
github.com/shurcooL/go/osutil
github.com/shurcooL/go/parserutil
github.com/shurcooL/go/pipeutil
github.com/shurcooL/go/printerutil
github.com/shurcooL/go/reflectfind
github.com/shurcooL/go/reflectsource
github.com/shurcooL/go/timeutil
github.com/shurcooL/go/trash
github.com/shurcooL/go/trim
github.com/shurcooL/go/vfs/godocfs/godocfs
github.com/shurcooL/go/vfs/godocfs/html/vfstemplate
github.com/shurcooL/go/vfs/godocfs/path/vfspath
github.com/shurcooL/go/vfs/godocfs/vfsutil
github.com/shurcooL/gostatus
github.com/shurcooL/gostatus/status
github.com/shurcooL/highlight_diff
github.com/shurcooL/highlight_go
github.com/shurcooL/htmlg
github.com/shurcooL/httperror
github.com/shurcooL/httpfs/filter
github.com/shurcooL/httpfs/html/vfstemplate
github.com/shurcooL/httpfs/httputil
github.com/shurcooL/httpfs/path/vfspath
github.com/shurcooL/httpfs/union
github.com/shurcooL/httpfs/vfsutil
github.com/shurcooL/httpgzip
github.com/shurcooL/octiconssvg
github.com/shurcooL/sanitized_anchor_name
github.com/shurcooL/vcsstate
github.com/sigurn/crc8
github.com/sigurn/utils
github.com/skratchdot/open-golang/open
github.com/slimsag/godocmd
github.com/smartystreets/assertions
github.com/smartystreets/assertions/assert
github.com/smartystreets/assertions/assert/example
github.com/smartystreets/assertions/internal/go-render/render
github.com/smartystreets/assertions/internal/oglematchers
github.com/smartystreets/assertions/should
github.com/smartystreets/goconvey
github.com/smartystreets/goconvey/convey
github.com/smartystreets/goconvey/convey/gotest
github.com/smartystreets/goconvey/convey/reporting
github.com/smartystreets/goconvey/examples
github.com/smartystreets/goconvey/web/server/api
github.com/smartystreets/goconvey/web/server/contract
github.com/smartystreets/goconvey/web/server/executor
github.com/smartystreets/goconvey/web/server/messaging
github.com/smartystreets/goconvey/web/server/parser
github.com/smartystreets/goconvey/web/server/system
github.com/smartystreets/goconvey/web/server/watch
github.com/smartystreets/goconvey/web/server/watch/integration_testing
github.com/smartystreets/goconvey/web/server/watch/integration_testing/sub
github.com/sourcegraph/annotate
github.com/sourcegraph/ctxvfs
github.com/sourcegraph/go-langserver
github.com/sourcegraph/go-langserver/langserver
github.com/sourcegraph/go-langserver/langserver/internal/gocode
github.com/sourcegraph/go-langserver/langserver/internal/godef
github.com/sourcegraph/go-langserver/langserver/internal/godef/go/parser
github.com/sourcegraph/go-langserver/langserver/internal/godef/go/types
github.com/sourcegraph/go-langserver/langserver/internal/refs
github.com/sourcegraph/go-langserver/langserver/internal/tools
github.com/sourcegraph/go-langserver/langserver/internal/utils
github.com/sourcegraph/go-langserver/pkg/lsp
github.com/sourcegraph/go-langserver/pkg/lspext
github.com/sourcegraph/jsonrpc2
github.com/sourcegraph/jsonrpc2/websocket
github.com/sourcegraph/syntaxhighlight
github.com/sourcegraph/syntaxhighlight/cmd/syntaxhighlight
github.com/spaolacci/murmur3
github.com/spf13/afero
github.com/spf13/afero/mem
github.com/spf13/afero/sftpfs
github.com/spf13/cast
github.com/spf13/cobra
github.com/spf13/cobra/cobra
github.com/spf13/cobra/cobra/cmd
github.com/spf13/cobra/doc
github.com/spf13/fsync
github.com/spf13/jwalterweatherman
github.com/spf13/nitro
github.com/spf13/pflag
github.com/spf13/viper
github.com/spf13/viper/remote
github.com/sqp/pulseaudio
github.com/sqp/pulseaudio/example
github.com/sqs/goreturns
github.com/sqs/goreturns/returns
github.com/square/certigo
github.com/square/certigo/jceks
github.com/square/certigo/lib
github.com/square/certigo/pkcs7
github.com/square/certigo/starttls
github.com/square/certigo/starttls/ldap
github.com/square/certigo/starttls/mysql
github.com/square/certigo/starttls/psql
github.com/square/certigo/starttls/psql/oid
github.com/stretchr/testify
github.com/stretchr/testify/assert
github.com/stretchr/testify/http
github.com/stretchr/testify/mock
github.com/stretchr/testify/require
github.com/stretchr/testify/suite
github.com/tarm/serial
github.com/tchap/go-patricia/patricia
github.com/termie/go-shutil
github.com/theupdateframework/notary
github.com/theupdateframework/notary/client
github.com/theupdateframework/notary/client/changelist
github.com/theupdateframework/notary/cmd/escrow
github.com/theupdateframework/notary/cmd/notary
github.com/theupdateframework/notary/cmd/notary-server
github.com/theupdateframework/notary/cmd/notary-signer
github.com/theupdateframework/notary/cryptoservice
github.com/theupdateframework/notary/passphrase
github.com/theupdateframework/notary/proto
github.com/theupdateframework/notary/server
github.com/theupdateframework/notary/server/errors
github.com/theupdateframework/notary/server/handlers
github.com/theupdateframework/notary/server/snapshot
github.com/theupdateframework/notary/server/storage
github.com/theupdateframework/notary/server/timestamp
github.com/theupdateframework/notary/signer
github.com/theupdateframework/notary/signer/api
github.com/theupdateframework/notary/signer/client
github.com/theupdateframework/notary/signer/keydbstore
github.com/theupdateframework/notary/storage
github.com/theupdateframework/notary/storage/rethinkdb
github.com/theupdateframework/notary/trustmanager
github.com/theupdateframework/notary/trustmanager/remoteks
github.com/theupdateframework/notary/trustmanager/yubikey
github.com/theupdateframework/notary/trustpinning
github.com/theupdateframework/notary/tuf
github.com/theupdateframework/notary/tuf/data
github.com/theupdateframework/notary/tuf/signed
github.com/theupdateframework/notary/tuf/testutils
github.com/theupdateframework/notary/tuf/testutils/interfaces
github.com/theupdateframework/notary/tuf/testutils/keys
github.com/theupdateframework/notary/tuf/utils
github.com/theupdateframework/notary/tuf/validation
github.com/theupdateframework/notary/utils
github.com/theupdateframework/notary/version
github.com/thrawn01/args
github.com/thrawn01/args/benchmark
github.com/thrawn01/args/examples/chicken-cli
github.com/thrawn01/args/examples/demo
github.com/thrawn01/args/examples/watch
github.com/tidwall/gjson
github.com/tidwall/match
github.com/tidwall/shiny
github.com/tidwall/shiny/benchmarks
github.com/tidwall/shiny/benchmarks/fasthttp-server
github.com/tidwall/shiny/benchmarks/net-echo-server
github.com/tidwall/shiny/benchmarks/net-http-server
github.com/tidwall/shiny/examples/echo-server
github.com/tidwall/shiny/examples/http-server
github.com/tidwall/shiny/examples/redis-server
github.com/tidwall/shiny/internal
github.com/tinylib/msgp
github.com/tinylib/msgp/gen
github.com/tinylib/msgp/msgp
github.com/tinylib/msgp/parse
github.com/tinylib/msgp/printer
github.com/tj/mmake/cmd/mmake
github.com/tj/mmake/help
github.com/tj/mmake/installer
github.com/tj/mmake/parser
github.com/tj/mmake/resolver
github.com/tj/node-prune
github.com/tj/node-prune/cmd/node-prune
github.com/tj/survey
github.com/tj/survey/core
github.com/tj/survey/examples
github.com/tj/survey/terminal
github.com/tj/survey/tests
github.com/tj/survey/tests/autoplay
github.com/tj/survey/tests/util
github.com/tobischo/gokeepasslib
github.com/tobischo/gokeepasslib/examples
github.com/tockins/interact
github.com/tockins/realize
github.com/tockins/realize/realize
github.com/tpng/gopkgs
github.com/tylerb/graceful
github.com/tylerb/graceful/tests
github.com/ugorji/go/codec
github.com/ugorji/go/codec/codecgen
github.com/ulikunitz/xz
github.com/ulikunitz/xz/cmd/gxz
github.com/ulikunitz/xz/cmd/xb
github.com/ulikunitz/xz/internal/gflag
github.com/ulikunitz/xz/internal/hash
github.com/ulikunitz/xz/internal/randtxt
github.com/ulikunitz/xz/internal/term
github.com/ulikunitz/xz/internal/xlog
github.com/ulikunitz/xz/lzma
github.com/urfave/cli
github.com/urfave/cli/altsrc
github.com/uudashr/gopkgs
github.com/uudashr/gopkgs/cmd/gopkgs
github.com/valyala/fasttemplate
github.com/vaughan0/go-ini
github.com/vbatts/tar-split/archive/tar
github.com/vbatts/tar-split/cmd/tar-split
github.com/vbatts/tar-split/tar/asm
github.com/vbatts/tar-split/tar/storage
github.com/vbatts/tar-split/version
github.com/veandco/go-sdl2/gfx
github.com/veandco/go-sdl2/img
github.com/veandco/go-sdl2/mix
github.com/veandco/go-sdl2/sdl
github.com/veandco/go-sdl2/ttf
github.com/wgliang/goreporter
github.com/wgliang/goreporter/engine
github.com/wgliang/goreporter/engine/processbar
github.com/wgliang/goreporter/linters/aligncheck
github.com/wgliang/goreporter/linters/copycheck
github.com/wgliang/goreporter/linters/copycheck/job
github.com/wgliang/goreporter/linters/copycheck/output
github.com/wgliang/goreporter/linters/copycheck/suffixtree
github.com/wgliang/goreporter/linters/copycheck/syntax
github.com/wgliang/goreporter/linters/copycheck/syntax/golang
github.com/wgliang/goreporter/linters/countcode
github.com/wgliang/goreporter/linters/cyclo
github.com/wgliang/goreporter/linters/deadcode
github.com/wgliang/goreporter/linters/depend
github.com/wgliang/goreporter/linters/depth
github.com/wgliang/goreporter/linters/errorcheck
github.com/wgliang/goreporter/linters/errorcheck/test
github.com/wgliang/goreporter/linters/flen
github.com/wgliang/goreporter/linters/gofmt
github.com/wgliang/goreporter/linters/golint
github.com/wgliang/goreporter/linters/golint/golint
github.com/wgliang/goreporter/linters/govet
github.com/wgliang/goreporter/linters/interfacer
github.com/wgliang/goreporter/linters/simplecode/gotool
github.com/wgliang/goreporter/linters/simpler/internal/sharedcheck
github.com/wgliang/goreporter/linters/spellcheck
github.com/wgliang/goreporter/linters/spellcheck/misspell
github.com/wgliang/goreporter/linters/spellcheck/misspell/stringreplacer
github.com/wgliang/goreporter/linters/staticcheck/functions
github.com/wgliang/goreporter/linters/staticcheck/internal/sharedcheck
github.com/wgliang/goreporter/linters/staticcheck/vrp
github.com/wgliang/goreporter/linters/structcheck
github.com/wgliang/goreporter/linters/unittest
github.com/wgliang/goreporter/linters/varcheck
github.com/wgliang/goreporter/utils
github.com/workfit/tester/assert
github.com/workfit/tester/ddt
github.com/x86kernel/htmlcolor
github.com/xeipuuv/gojsonpointer
github.com/xeipuuv/gojsonreference
github.com/xeipuuv/gojsonschema
github.com/xenolf/lego
github.com/xenolf/lego/acme
github.com/xenolf/lego/providers/dns
github.com/xenolf/lego/providers/dns/auroradns
github.com/xenolf/lego/providers/dns/azure
github.com/xenolf/lego/providers/dns/cloudflare
github.com/xenolf/lego/providers/dns/digitalocean
github.com/xenolf/lego/providers/dns/dnsimple
github.com/xenolf/lego/providers/dns/dnsmadeeasy
github.com/xenolf/lego/providers/dns/dnspod
github.com/xenolf/lego/providers/dns/dyn
github.com/xenolf/lego/providers/dns/exoscale
github.com/xenolf/lego/providers/dns/gandi
github.com/xenolf/lego/providers/dns/godaddy
github.com/xenolf/lego/providers/dns/googlecloud
github.com/xenolf/lego/providers/dns/linode
github.com/xenolf/lego/providers/dns/namecheap
github.com/xenolf/lego/providers/dns/ns1
github.com/xenolf/lego/providers/dns/otc
github.com/xenolf/lego/providers/dns/ovh
github.com/xenolf/lego/providers/dns/pdns
github.com/xenolf/lego/providers/dns/rackspace
github.com/xenolf/lego/providers/dns/rfc2136
github.com/xenolf/lego/providers/dns/route53
github.com/xenolf/lego/providers/dns/vultr
github.com/xenolf/lego/providers/http/memcached
github.com/xenolf/lego/providers/http/webroot
github.com/xi2/xz
github.com/xinsnake/go-http-digest-auth-client
github.com/xinsnake/go-http-digest-auth-client/tests
github.com/xo/dburl
github.com/xo/dburl/example
github.com/xo/terminfo
github.com/xo/terminfo/cmd/infocmp
github.com/xo/terminfo/examples/simple
github.com/xo/usql
github.com/xo/usql/drivers
github.com/xo/usql/drivers/adodb
github.com/xo/usql/drivers/avatica
github.com/xo/usql/drivers/clickhouse
github.com/xo/usql/drivers/couchbase
github.com/xo/usql/drivers/firebird
github.com/xo/usql/drivers/mssql
github.com/xo/usql/drivers/mymysql
github.com/xo/usql/drivers/mysql
github.com/xo/usql/drivers/odbc
github.com/xo/usql/drivers/oracle
github.com/xo/usql/drivers/pgx
github.com/xo/usql/drivers/postgres
github.com/xo/usql/drivers/presto
github.com/xo/usql/drivers/ql
github.com/xo/usql/drivers/saphana
github.com/xo/usql/drivers/sqlite3
github.com/xo/usql/drivers/voltdb
github.com/xo/usql/env
github.com/xo/usql/handler
github.com/xo/usql/internal
github.com/xo/usql/metacmd
github.com/xo/usql/rline
github.com/xo/usql/stmt
github.com/xo/usql/styles
github.com/xo/usql/text
github.com/xo/xoutil
github.com/xordataexchange/crypt/backend
github.com/xordataexchange/crypt/backend/consul
github.com/xordataexchange/crypt/backend/etcd
github.com/xordataexchange/crypt/backend/mock
github.com/xordataexchange/crypt/bin/crypt
github.com/xordataexchange/crypt/config
github.com/xordataexchange/crypt/encoding/secconf
github.com/yahoo/gryffin
github.com/yahoo/gryffin/cmd/gryffin-distributed
github.com/yahoo/gryffin/cmd/gryffin-standalone
github.com/yahoo/gryffin/data
github.com/yahoo/gryffin/fuzzer/arachni
github.com/yahoo/gryffin/fuzzer/dummy
github.com/yahoo/gryffin/fuzzer/sqlmap
github.com/yahoo/gryffin/html-distance
github.com/yahoo/gryffin/renderer
github.com/yahoo/gryffin/renderer/resource
github.com/ymomoi/goval-parser
github.com/ymomoi/goval-parser/oval
github.com/yosssi/ace
github.com/yosssi/ace/cmd/ace
github.com/yosssi/ace/examples/actions
github.com/yosssi/ace/examples/base_inner_template
github.com/yosssi/ace/examples/cache_options
github.com/yosssi/ace/examples/change_action_delimiter
github.com/yosssi/ace/examples/comments
github.com/yosssi/ace/examples/css_javascript_helper_method
github.com/yosssi/ace/examples/dynamic_reload
github.com/yosssi/ace/examples/external_css_and_js
github.com/yosssi/ace/examples/html_tags
github.com/yosssi/ace/examples/include_helper_method
github.com/yosssi/ace/examples/load_templates_from_binary_data
github.com/yosssi/ace/examples/pass_pipeline_to_included_template
github.com/yosssi/ace/examples/plain_texts
github.com/yosssi/ace/examples/set_custom_functions
github.com/yosssi/ace/examples/set_default_value_to_the_yield_helper_method
github.com/yosssi/ace/examples/single_template
github.com/zaf/temp
github.com/zillow/godash
github.com/ziutek/mymysql
github.com/ziutek/mymysql/autorc
github.com/ziutek/mymysql/examples/database_sql
github.com/ziutek/mymysql/examples/long_data
github.com/ziutek/mymysql/examples/parallel
github.com/ziutek/mymysql/examples/prepared_stmt
github.com/ziutek/mymysql/examples/reconnect
github.com/ziutek/mymysql/examples/simple
github.com/ziutek/mymysql/examples/transactions
github.com/ziutek/mymysql/godrv
github.com/ziutek/mymysql/mysql
github.com/ziutek/mymysql/native
github.com/ziutek/mymysql/thrsafe
github.com/ziutek/telnet
github.com/ziutek/telnet/telnet_example
github.com/zmb3/gogetdoc
go.mozilla.org/sops
go.mozilla.org/sops/aes
go.mozilla.org/sops/cmd/sops
go.mozilla.org/sops/cmd/sops/codes
go.mozilla.org/sops/cmd/sops/common
go.mozilla.org/sops/cmd/sops/subcommand/groups
go.mozilla.org/sops/cmd/sops/subcommand/keyservice
go.mozilla.org/sops/cmd/sops/subcommand/updatekeys
go.mozilla.org/sops/config
go.mozilla.org/sops/decrypt
go.mozilla.org/sops/gcpkms
go.mozilla.org/sops/keys
go.mozilla.org/sops/keyservice
go.mozilla.org/sops/kms
go.mozilla.org/sops/kms/mocks
go.mozilla.org/sops/logging
go.mozilla.org/sops/pgp
go.mozilla.org/sops/shamir
go.mozilla.org/sops/stores
go.mozilla.org/sops/stores/json
go.mozilla.org/sops/stores/yaml
go4.org/bytereplacer
go4.org/cloud/cloudlaunch
go4.org/cloud/google/gceutil
go4.org/cloud/google/gcsutil
go4.org/ctxutil
go4.org/errorutil
go4.org/fault
go4.org/jsonconfig
go4.org/legal
go4.org/lock
go4.org/net/throttle
go4.org/oauthutil
go4.org/osutil
go4.org/readerutil
go4.org/readerutil/singlereader
go4.org/reflectutil
go4.org/sort
go4.org/strutil
go4.org/syncutil
go4.org/syncutil/singleflight
go4.org/syncutil/syncdebug
go4.org/testing/functest
go4.org/types
go4.org/wkfs
go4.org/wkfs/gcs
go4.org/writerutil
go4.org/xdgdir
gobot.io/x/gobot
gobot.io/x/gobot/api
gobot.io/x/gobot/api/robeaux
gobot.io/x/gobot/cli
gobot.io/x/gobot/drivers/aio
gobot.io/x/gobot/drivers/gpio
gobot.io/x/gobot/drivers/i2c
gobot.io/x/gobot/drivers/spi
gobot.io/x/gobot/examples
gobot.io/x/gobot/gobottest
gobot.io/x/gobot/platforms/audio
gobot.io/x/gobot/platforms/beaglebone
gobot.io/x/gobot/platforms/ble
gobot.io/x/gobot/platforms/chip
gobot.io/x/gobot/platforms/dexter
gobot.io/x/gobot/platforms/dexter/gopigo3
gobot.io/x/gobot/platforms/digispark
gobot.io/x/gobot/platforms/dragonboard
gobot.io/x/gobot/platforms/firmata
gobot.io/x/gobot/platforms/firmata/client
gobot.io/x/gobot/platforms/holystone
gobot.io/x/gobot/platforms/holystone/hs200
gobot.io/x/gobot/platforms/intel-iot
gobot.io/x/gobot/platforms/intel-iot/curie
gobot.io/x/gobot/platforms/intel-iot/edison
gobot.io/x/gobot/platforms/intel-iot/joule
gobot.io/x/gobot/platforms/joystick
gobot.io/x/gobot/platforms/joystick/bin
gobot.io/x/gobot/platforms/keyboard
gobot.io/x/gobot/platforms/leap
gobot.io/x/gobot/platforms/mavlink
gobot.io/x/gobot/platforms/mavlink/common
gobot.io/x/gobot/platforms/megapi
gobot.io/x/gobot/platforms/microbit
gobot.io/x/gobot/platforms/mqtt
gobot.io/x/gobot/platforms/nats
gobot.io/x/gobot/platforms/neurosky
gobot.io/x/gobot/platforms/opencv
gobot.io/x/gobot/platforms/parrot
gobot.io/x/gobot/platforms/parrot/ardrone
gobot.io/x/gobot/platforms/parrot/bebop
gobot.io/x/gobot/platforms/parrot/bebop/client
gobot.io/x/gobot/platforms/parrot/minidrone
gobot.io/x/gobot/platforms/particle
gobot.io/x/gobot/platforms/pebble
gobot.io/x/gobot/platforms/raspi
gobot.io/x/gobot/platforms/sphero
gobot.io/x/gobot/platforms/sphero/bb8
gobot.io/x/gobot/platforms/sphero/ollie
gobot.io/x/gobot/platforms/sphero/sprkplus
gobot.io/x/gobot/platforms/tinkerboard
gobot.io/x/gobot/platforms/upboard
gobot.io/x/gobot/platforms/upboard/up2
gobot.io/x/gobot/sysfs
golang.org/x/build
golang.org/x/build/auth
golang.org/x/build/autocertcache
golang.org/x/build/buildenv
golang.org/x/build/buildlet
golang.org/x/build/cmd/builder
golang.org/x/build/cmd/buildlet
golang.org/x/build/cmd/buildlet/stage0
golang.org/x/build/cmd/buildstats
golang.org/x/build/cmd/cl
golang.org/x/build/cmd/coordinator
golang.org/x/build/cmd/coordinator/buildongce
golang.org/x/build/cmd/coordinator/metrics
golang.org/x/build/cmd/coordinator/spanlog
golang.org/x/build/cmd/debugnewvm
golang.org/x/build/cmd/docker2boot
golang.org/x/build/cmd/fetchlogs
golang.org/x/build/cmd/genbootstrap
golang.org/x/build/cmd/gerritbot
golang.org/x/build/cmd/gitlock
golang.org/x/build/cmd/gitmirror
golang.org/x/build/cmd/gomote
golang.org/x/build/cmd/gopherbot
golang.org/x/build/cmd/gopherstats
golang.org/x/build/cmd/makemac
golang.org/x/build/cmd/perfrun
golang.org/x/build/cmd/pubsubhelper
golang.org/x/build/cmd/pubsubhelper/pubsubtypes
golang.org/x/build/cmd/pushback
golang.org/x/build/cmd/racebuild
golang.org/x/build/cmd/release
golang.org/x/build/cmd/releasebot
golang.org/x/build/cmd/relnote
golang.org/x/build/cmd/retrybuilds
golang.org/x/build/cmd/rundockerbuildlet
golang.org/x/build/cmd/scaleway
golang.org/x/build/cmd/upload
golang.org/x/build/dashboard
golang.org/x/build/devapp
golang.org/x/build/envutil
golang.org/x/build/gerrit
golang.org/x/build/internal/buildgo
golang.org/x/build/internal/buildstats
golang.org/x/build/internal/gophers
golang.org/x/build/internal/httpdl
golang.org/x/build/internal/https
golang.org/x/build/internal/loghash
golang.org/x/build/internal/lru
golang.org/x/build/internal/singleflight
golang.org/x/build/internal/sourcecache
golang.org/x/build/internal/untar
golang.org/x/build/kubernetes
golang.org/x/build/kubernetes/api
golang.org/x/build/kubernetes/gke
golang.org/x/build/livelog
golang.org/x/build/maintner
golang.org/x/build/maintner/cmd/maintserve
golang.org/x/build/maintner/godata
golang.org/x/build/maintner/gostats
golang.org/x/build/maintner/maintnerd
golang.org/x/build/maintner/maintnerd/apipb
golang.org/x/build/maintner/maintpb
golang.org/x/build/maintner/maintq
golang.org/x/build/maintner/reclog
golang.org/x/build/pargzip
golang.org/x/build/revdial
golang.org/x/build/tarutil
golang.org/x/build/types
golang.org/x/build/vcs-test/vcweb
golang.org/x/build/version
golang.org/x/build/version/go1.10beta1
golang.org/x/build/version/go1.10beta2
golang.org/x/build/version/go1.8
golang.org/x/build/version/go1.8.1
golang.org/x/build/version/go1.8.2
golang.org/x/build/version/go1.8.3
golang.org/x/build/version/go1.8.4
golang.org/x/build/version/go1.8.5
golang.org/x/build/version/go1.8beta1
golang.org/x/build/version/go1.8beta2
golang.org/x/build/version/go1.8rc1
golang.org/x/build/version/go1.8rc2
golang.org/x/build/version/go1.8rc3
golang.org/x/build/version/go1.9
golang.org/x/build/version/go1.9.1
golang.org/x/build/version/go1.9.2
golang.org/x/build/version/go1.9beta1
golang.org/x/build/version/go1.9beta2
golang.org/x/build/version/go1.9rc1
golang.org/x/build/version/go1.9rc2
golang.org/x/crypto/acme
golang.org/x/crypto/acme/autocert
golang.org/x/crypto/argon2
golang.org/x/crypto/bcrypt
golang.org/x/crypto/blake2b
golang.org/x/crypto/blake2s
golang.org/x/crypto/blowfish
golang.org/x/crypto/bn256
golang.org/x/crypto/cast5
golang.org/x/crypto/chacha20poly1305
golang.org/x/crypto/cryptobyte
golang.org/x/crypto/cryptobyte/asn1
golang.org/x/crypto/curve25519
golang.org/x/crypto/ed25519
golang.org/x/crypto/ed25519/internal/edwards25519
golang.org/x/crypto/hkdf
golang.org/x/crypto/internal/chacha20
golang.org/x/crypto/md4
golang.org/x/crypto/nacl/auth
golang.org/x/crypto/nacl/box
golang.org/x/crypto/nacl/secretbox
golang.org/x/crypto/ocsp
golang.org/x/crypto/openpgp
golang.org/x/crypto/openpgp/armor
golang.org/x/crypto/openpgp/clearsign
golang.org/x/crypto/openpgp/elgamal
golang.org/x/crypto/openpgp/errors
golang.org/x/crypto/openpgp/packet
golang.org/x/crypto/openpgp/s2k
golang.org/x/crypto/otr
golang.org/x/crypto/pbkdf2
golang.org/x/crypto/pkcs12
golang.org/x/crypto/pkcs12/internal/rc2
golang.org/x/crypto/poly1305
golang.org/x/crypto/ripemd160
golang.org/x/crypto/salsa20
golang.org/x/crypto/salsa20/salsa
golang.org/x/crypto/scrypt
golang.org/x/crypto/sha3
golang.org/x/crypto/ssh
golang.org/x/crypto/ssh/agent
golang.org/x/crypto/ssh/knownhosts
golang.org/x/crypto/ssh/terminal
golang.org/x/crypto/ssh/test
golang.org/x/crypto/tea
golang.org/x/crypto/twofish
golang.org/x/crypto/xtea
golang.org/x/crypto/xts
golang.org/x/image/bmp
golang.org/x/image/colornames
golang.org/x/image/draw
golang.org/x/image/font
golang.org/x/image/font/basicfont
golang.org/x/image/font/gofont/gobold
golang.org/x/image/font/gofont/gobolditalic
golang.org/x/image/font/gofont/goitalic
golang.org/x/image/font/gofont/gomedium
golang.org/x/image/font/gofont/gomediumitalic
golang.org/x/image/font/gofont/gomono
golang.org/x/image/font/gofont/gomonobold
golang.org/x/image/font/gofont/gomonobolditalic
golang.org/x/image/font/gofont/gomonoitalic
golang.org/x/image/font/gofont/goregular
golang.org/x/image/font/gofont/gosmallcaps
golang.org/x/image/font/gofont/gosmallcapsitalic
golang.org/x/image/font/inconsolata
golang.org/x/image/font/opentype
golang.org/x/image/font/plan9font
golang.org/x/image/font/sfnt
golang.org/x/image/math/f32
golang.org/x/image/math/f64
golang.org/x/image/math/fixed
golang.org/x/image/riff
golang.org/x/image/tiff
golang.org/x/image/tiff/lzw
golang.org/x/image/vector
golang.org/x/image/vp8
golang.org/x/image/vp8l
golang.org/x/image/webp
golang.org/x/image/webp/nycbcra
golang.org/x/net/bpf
golang.org/x/net/context
golang.org/x/net/context/ctxhttp
golang.org/x/net/dict
golang.org/x/net/dns/dnsmessage
golang.org/x/net/html
golang.org/x/net/html/atom
golang.org/x/net/html/charset
golang.org/x/net/http/httpproxy
golang.org/x/net/http2
golang.org/x/net/http2/h2i
golang.org/x/net/http2/hpack
golang.org/x/net/icmp
golang.org/x/net/idna
golang.org/x/net/internal/iana
golang.org/x/net/internal/nettest
golang.org/x/net/internal/socket
golang.org/x/net/internal/timeseries
golang.org/x/net/ipv4
golang.org/x/net/ipv6
golang.org/x/net/lex/httplex
golang.org/x/net/nettest
golang.org/x/net/netutil
golang.org/x/net/proxy
golang.org/x/net/publicsuffix
golang.org/x/net/trace
golang.org/x/net/webdav
golang.org/x/net/webdav/internal/xml
golang.org/x/net/websocket
golang.org/x/net/xsrftoken
golang.org/x/oauth2
golang.org/x/oauth2/amazon
golang.org/x/oauth2/bitbucket
golang.org/x/oauth2/clientcredentials
golang.org/x/oauth2/facebook
golang.org/x/oauth2/fitbit
golang.org/x/oauth2/foursquare
golang.org/x/oauth2/github
golang.org/x/oauth2/google
golang.org/x/oauth2/heroku
golang.org/x/oauth2/hipchat
golang.org/x/oauth2/internal
golang.org/x/oauth2/jws
golang.org/x/oauth2/jwt
golang.org/x/oauth2/linkedin
golang.org/x/oauth2/mailru
golang.org/x/oauth2/mediamath
golang.org/x/oauth2/microsoft
golang.org/x/oauth2/odnoklassniki
golang.org/x/oauth2/paypal
golang.org/x/oauth2/slack
golang.org/x/oauth2/spotify
golang.org/x/oauth2/twitch
golang.org/x/oauth2/uber
golang.org/x/oauth2/vk
golang.org/x/oauth2/yahoo
golang.org/x/oauth2/yandex
golang.org/x/release-branch.go1.4/doc/articles/wiki
golang.org/x/release-branch.go1.4/doc/codewalk
golang.org/x/release-branch.go1.4/doc/play
golang.org/x/release-branch.go1.4/misc/android
golang.org/x/release-branch.go1.4/misc/cgo/errors
golang.org/x/release-branch.go1.4/misc/cgo/gmp
golang.org/x/release-branch.go1.4/misc/cgo/life
golang.org/x/release-branch.go1.4/misc/cgo/nocgo
golang.org/x/release-branch.go1.4/misc/cgo/stdio
golang.org/x/release-branch.go1.4/misc/cgo/test
golang.org/x/release-branch.go1.4/misc/cgo/test/backdoor
golang.org/x/release-branch.go1.4/misc/cgo/test/issue8828
golang.org/x/release-branch.go1.4/misc/cgo/test/issue9026
golang.org/x/release-branch.go1.4/misc/cgo/testasan
golang.org/x/release-branch.go1.4/misc/cgo/testgodefs
golang.org/x/release-branch.go1.4/misc/cgo/testso
golang.org/x/release-branch.go1.4/misc/cgo/testtls
golang.org/x/release-branch.go1.4/misc/dashboard/codereview/dashboard
golang.org/x/release-branch.go1.4/misc/linkcheck
golang.org/x/release-branch.go1.4/misc/makerelease
golang.org/x/release-branch.go1.4/misc/nacl
golang.org/x/release-branch.go1.4/misc/swig/callback
golang.org/x/release-branch.go1.4/misc/swig/stdio
golang.org/x/release-branch.go1.4/src/archive/tar
golang.org/x/release-branch.go1.4/src/archive/zip
golang.org/x/release-branch.go1.4/src/bufio
golang.org/x/release-branch.go1.4/src/builtin
golang.org/x/release-branch.go1.4/src/bytes
golang.org/x/release-branch.go1.4/src/cmd/addr2line
golang.org/x/release-branch.go1.4/src/cmd/cgo
golang.org/x/release-branch.go1.4/src/cmd/fix
golang.org/x/release-branch.go1.4/src/cmd/go
golang.org/x/release-branch.go1.4/src/cmd/gofmt
golang.org/x/release-branch.go1.4/src/cmd/internal/goobj
golang.org/x/release-branch.go1.4/src/cmd/internal/objfile
golang.org/x/release-branch.go1.4/src/cmd/internal/rsc.io/arm/armasm
golang.org/x/release-branch.go1.4/src/cmd/internal/rsc.io/x86/x86asm
golang.org/x/release-branch.go1.4/src/cmd/nm
golang.org/x/release-branch.go1.4/src/cmd/objdump
golang.org/x/release-branch.go1.4/src/cmd/pack
golang.org/x/release-branch.go1.4/src/cmd/pprof
golang.org/x/release-branch.go1.4/src/cmd/pprof/internal/commands
golang.org/x/release-branch.go1.4/src/cmd/pprof/internal/driver
golang.org/x/release-branch.go1.4/src/cmd/pprof/internal/fetch
golang.org/x/release-branch.go1.4/src/cmd/pprof/internal/plugin
golang.org/x/release-branch.go1.4/src/cmd/pprof/internal/profile
golang.org/x/release-branch.go1.4/src/cmd/pprof/internal/report
golang.org/x/release-branch.go1.4/src/cmd/pprof/internal/svg
golang.org/x/release-branch.go1.4/src/cmd/pprof/internal/symbolizer
golang.org/x/release-branch.go1.4/src/cmd/pprof/internal/symbolz
golang.org/x/release-branch.go1.4/src/cmd/pprof/internal/tempfile
golang.org/x/release-branch.go1.4/src/cmd/yacc
golang.org/x/release-branch.go1.4/src/compress/bzip2
golang.org/x/release-branch.go1.4/src/compress/flate
golang.org/x/release-branch.go1.4/src/compress/gzip
golang.org/x/release-branch.go1.4/src/compress/lzw
golang.org/x/release-branch.go1.4/src/compress/zlib
golang.org/x/release-branch.go1.4/src/container/heap
golang.org/x/release-branch.go1.4/src/container/list
golang.org/x/release-branch.go1.4/src/container/ring
golang.org/x/release-branch.go1.4/src/crypto
golang.org/x/release-branch.go1.4/src/crypto/aes
golang.org/x/release-branch.go1.4/src/crypto/cipher
golang.org/x/release-branch.go1.4/src/crypto/des
golang.org/x/release-branch.go1.4/src/crypto/dsa
golang.org/x/release-branch.go1.4/src/crypto/ecdsa
golang.org/x/release-branch.go1.4/src/crypto/elliptic
golang.org/x/release-branch.go1.4/src/crypto/hmac
golang.org/x/release-branch.go1.4/src/crypto/md5
golang.org/x/release-branch.go1.4/src/crypto/rand
golang.org/x/release-branch.go1.4/src/crypto/rc4
golang.org/x/release-branch.go1.4/src/crypto/rsa
golang.org/x/release-branch.go1.4/src/crypto/sha1
golang.org/x/release-branch.go1.4/src/crypto/sha256
golang.org/x/release-branch.go1.4/src/crypto/sha512
golang.org/x/release-branch.go1.4/src/crypto/subtle
golang.org/x/release-branch.go1.4/src/crypto/tls
golang.org/x/release-branch.go1.4/src/crypto/x509
golang.org/x/release-branch.go1.4/src/crypto/x509/pkix
golang.org/x/release-branch.go1.4/src/database/sql
golang.org/x/release-branch.go1.4/src/database/sql/driver
golang.org/x/release-branch.go1.4/src/debug/dwarf
golang.org/x/release-branch.go1.4/src/debug/elf
golang.org/x/release-branch.go1.4/src/debug/gosym
golang.org/x/release-branch.go1.4/src/debug/macho
golang.org/x/release-branch.go1.4/src/debug/pe
golang.org/x/release-branch.go1.4/src/debug/plan9obj
golang.org/x/release-branch.go1.4/src/encoding
golang.org/x/release-branch.go1.4/src/encoding/ascii85
golang.org/x/release-branch.go1.4/src/encoding/asn1
golang.org/x/release-branch.go1.4/src/encoding/base32
golang.org/x/release-branch.go1.4/src/encoding/base64
golang.org/x/release-branch.go1.4/src/encoding/binary
golang.org/x/release-branch.go1.4/src/encoding/csv
golang.org/x/release-branch.go1.4/src/encoding/gob
golang.org/x/release-branch.go1.4/src/encoding/hex
golang.org/x/release-branch.go1.4/src/encoding/json
golang.org/x/release-branch.go1.4/src/encoding/pem
golang.org/x/release-branch.go1.4/src/encoding/xml
golang.org/x/release-branch.go1.4/src/errors
golang.org/x/release-branch.go1.4/src/expvar
golang.org/x/release-branch.go1.4/src/flag
golang.org/x/release-branch.go1.4/src/fmt
golang.org/x/release-branch.go1.4/src/go/ast
golang.org/x/release-branch.go1.4/src/go/build
golang.org/x/release-branch.go1.4/src/go/doc
golang.org/x/release-branch.go1.4/src/go/format
golang.org/x/release-branch.go1.4/src/go/parser
golang.org/x/release-branch.go1.4/src/go/printer
golang.org/x/release-branch.go1.4/src/go/scanner
golang.org/x/release-branch.go1.4/src/go/token
golang.org/x/release-branch.go1.4/src/hash
golang.org/x/release-branch.go1.4/src/hash/adler32
golang.org/x/release-branch.go1.4/src/hash/crc32
golang.org/x/release-branch.go1.4/src/hash/crc64
golang.org/x/release-branch.go1.4/src/hash/fnv
golang.org/x/release-branch.go1.4/src/html
golang.org/x/release-branch.go1.4/src/html/template
golang.org/x/release-branch.go1.4/src/image
golang.org/x/release-branch.go1.4/src/image/color
golang.org/x/release-branch.go1.4/src/image/color/palette
golang.org/x/release-branch.go1.4/src/image/draw
golang.org/x/release-branch.go1.4/src/image/gif
golang.org/x/release-branch.go1.4/src/image/jpeg
golang.org/x/release-branch.go1.4/src/image/png
golang.org/x/release-branch.go1.4/src/index/suffixarray
golang.org/x/release-branch.go1.4/src/internal/syscall
golang.org/x/release-branch.go1.4/src/io
golang.org/x/release-branch.go1.4/src/io/ioutil
golang.org/x/release-branch.go1.4/src/log
golang.org/x/release-branch.go1.4/src/log/syslog
golang.org/x/release-branch.go1.4/src/math
golang.org/x/release-branch.go1.4/src/math/big
golang.org/x/release-branch.go1.4/src/math/cmplx
golang.org/x/release-branch.go1.4/src/math/rand
golang.org/x/release-branch.go1.4/src/mime
golang.org/x/release-branch.go1.4/src/mime/multipart
golang.org/x/release-branch.go1.4/src/net
golang.org/x/release-branch.go1.4/src/net/http
golang.org/x/release-branch.go1.4/src/net/http/cgi
golang.org/x/release-branch.go1.4/src/net/http/cookiejar
golang.org/x/release-branch.go1.4/src/net/http/fcgi
golang.org/x/release-branch.go1.4/src/net/http/httptest
golang.org/x/release-branch.go1.4/src/net/http/httputil
golang.org/x/release-branch.go1.4/src/net/http/internal
golang.org/x/release-branch.go1.4/src/net/http/pprof
golang.org/x/release-branch.go1.4/src/net/mail
golang.org/x/release-branch.go1.4/src/net/rpc
golang.org/x/release-branch.go1.4/src/net/rpc/jsonrpc
golang.org/x/release-branch.go1.4/src/net/smtp
golang.org/x/release-branch.go1.4/src/net/textproto
golang.org/x/release-branch.go1.4/src/net/url
golang.org/x/release-branch.go1.4/src/os
golang.org/x/release-branch.go1.4/src/os/exec
golang.org/x/release-branch.go1.4/src/os/signal
golang.org/x/release-branch.go1.4/src/os/user
golang.org/x/release-branch.go1.4/src/path
golang.org/x/release-branch.go1.4/src/path/filepath
golang.org/x/release-branch.go1.4/src/reflect
golang.org/x/release-branch.go1.4/src/regexp
golang.org/x/release-branch.go1.4/src/regexp/syntax
golang.org/x/release-branch.go1.4/src/runtime/cgo
golang.org/x/release-branch.go1.4/src/runtime/debug
golang.org/x/release-branch.go1.4/src/runtime/pprof
golang.org/x/release-branch.go1.4/src/runtime/race
golang.org/x/release-branch.go1.4/src/sort
golang.org/x/release-branch.go1.4/src/strconv
golang.org/x/release-branch.go1.4/src/strings
golang.org/x/release-branch.go1.4/src/sync
golang.org/x/release-branch.go1.4/src/sync/atomic
golang.org/x/release-branch.go1.4/src/syscall
golang.org/x/release-branch.go1.4/src/testing
golang.org/x/release-branch.go1.4/src/testing/iotest
golang.org/x/release-branch.go1.4/src/testing/quick
golang.org/x/release-branch.go1.4/src/text/scanner
golang.org/x/release-branch.go1.4/src/text/tabwriter
golang.org/x/release-branch.go1.4/src/text/template
golang.org/x/release-branch.go1.4/src/text/template/parse
golang.org/x/release-branch.go1.4/src/time
golang.org/x/release-branch.go1.4/src/unicode
golang.org/x/release-branch.go1.4/src/unicode/utf16
golang.org/x/release-branch.go1.4/src/unicode/utf8
golang.org/x/release-branch.go1.4/src/unsafe
golang.org/x/release-branch.go1.4/test/bench/garbage
golang.org/x/release-branch.go1.4/test/bench/go1
golang.org/x/release-branch.go1.4/test/bugs
golang.org/x/release-branch.go1.4/test/chan
golang.org/x/release-branch.go1.4/test/dwarf/dwarf.dir
golang.org/x/release-branch.go1.4/test/fixedbugs/bug313.dir
golang.org/x/release-branch.go1.4/test/fixedbugs/bug369.dir
golang.org/x/release-branch.go1.4/test/fixedbugs/bug488.dir
golang.org/x/release-branch.go1.4/test/fixedbugs/issue4510.dir
golang.org/x/release-branch.go1.4/test/ken
golang.org/x/release-branch.go1.4/test/stress
golang.org/x/review/git-codereview
golang.org/x/sync/errgroup
golang.org/x/sync/semaphore
golang.org/x/sync/singleflight
golang.org/x/sync/syncmap
golang.org/x/sys/unix
golang.org/x/sys/windows
golang.org/x/sys/windows/registry
golang.org/x/text
golang.org/x/text/cases
golang.org/x/text/cmd/gotext
golang.org/x/text/cmd/gotext/examples/extract
golang.org/x/text/cmd/gotext/examples/extract_http
golang.org/x/text/cmd/gotext/examples/extract_http/pkg
golang.org/x/text/cmd/gotext/examples/rewrite
golang.org/x/text/collate
golang.org/x/text/collate/build
golang.org/x/text/collate/tools/colcmp
golang.org/x/text/currency
golang.org/x/text/date
golang.org/x/text/encoding
golang.org/x/text/encoding/charmap
golang.org/x/text/encoding/htmlindex
golang.org/x/text/encoding/ianaindex
golang.org/x/text/encoding/internal
golang.org/x/text/encoding/internal/enctest
golang.org/x/text/encoding/internal/identifier
golang.org/x/text/encoding/japanese
golang.org/x/text/encoding/korean
golang.org/x/text/encoding/simplifiedchinese
golang.org/x/text/encoding/traditionalchinese
golang.org/x/text/encoding/unicode
golang.org/x/text/encoding/unicode/utf32
golang.org/x/text/feature/plural
golang.org/x/text/internal
golang.org/x/text/internal/catmsg
golang.org/x/text/internal/cldrtree
golang.org/x/text/internal/colltab
golang.org/x/text/internal/export/idna
golang.org/x/text/internal/format
golang.org/x/text/internal/gen
golang.org/x/text/internal/number
golang.org/x/text/internal/stringset
golang.org/x/text/internal/tag
golang.org/x/text/internal/testtext
golang.org/x/text/internal/triegen
golang.org/x/text/internal/ucd
golang.org/x/text/internal/utf8internal
golang.org/x/text/language
golang.org/x/text/language/display
golang.org/x/text/message
golang.org/x/text/message/catalog
golang.org/x/text/message/pipeline
golang.org/x/text/number
golang.org/x/text/runes
golang.org/x/text/search
golang.org/x/text/secure
golang.org/x/text/secure/bidirule
golang.org/x/text/secure/precis
golang.org/x/text/transform
golang.org/x/text/unicode
golang.org/x/text/unicode/bidi
golang.org/x/text/unicode/cldr
golang.org/x/text/unicode/norm
golang.org/x/text/unicode/rangetable
golang.org/x/text/unicode/runenames
golang.org/x/text/width
golang.org/x/time/rate
golang.org/x/tools/benchmark/parse
golang.org/x/tools/blog
golang.org/x/tools/blog/atom
golang.org/x/tools/cmd/benchcmp
golang.org/x/tools/cmd/bundle
golang.org/x/tools/cmd/callgraph
golang.org/x/tools/cmd/compilebench
golang.org/x/tools/cmd/cover
golang.org/x/tools/cmd/digraph
golang.org/x/tools/cmd/eg
golang.org/x/tools/cmd/fiximports
golang.org/x/tools/cmd/getgo
golang.org/x/tools/cmd/getgo/server
golang.org/x/tools/cmd/go-contrib-init
golang.org/x/tools/cmd/godex
golang.org/x/tools/cmd/godoc
golang.org/x/tools/cmd/goimports
golang.org/x/tools/cmd/gomvpkg
golang.org/x/tools/cmd/gorename
golang.org/x/tools/cmd/gotype
golang.org/x/tools/cmd/goyacc
golang.org/x/tools/cmd/guru
golang.org/x/tools/cmd/guru/serial
golang.org/x/tools/cmd/heapview
golang.org/x/tools/cmd/heapview/internal/core
golang.org/x/tools/cmd/html2article
golang.org/x/tools/cmd/present
golang.org/x/tools/cmd/ssadump
golang.org/x/tools/cmd/stress
golang.org/x/tools/cmd/stringer
golang.org/x/tools/cmd/tip
golang.org/x/tools/cmd/toolstash
golang.org/x/tools/container/intsets
golang.org/x/tools/cover
golang.org/x/tools/go/ast/astutil
golang.org/x/tools/go/buildutil
golang.org/x/tools/go/callgraph
golang.org/x/tools/go/callgraph/cha
golang.org/x/tools/go/callgraph/rta
golang.org/x/tools/go/callgraph/static
golang.org/x/tools/go/gccgoexportdata
golang.org/x/tools/go/gcexportdata
golang.org/x/tools/go/gcimporter15
golang.org/x/tools/go/internal/gccgoimporter
golang.org/x/tools/go/loader
golang.org/x/tools/go/pointer
golang.org/x/tools/go/ssa
golang.org/x/tools/go/ssa/interp
golang.org/x/tools/go/ssa/ssautil
golang.org/x/tools/go/types/typeutil
golang.org/x/tools/go/vcs
golang.org/x/tools/godoc
golang.org/x/tools/godoc/analysis
golang.org/x/tools/godoc/redirect
golang.org/x/tools/godoc/static
golang.org/x/tools/godoc/util
golang.org/x/tools/godoc/vfs
golang.org/x/tools/godoc/vfs/gatefs
golang.org/x/tools/godoc/vfs/httpfs
golang.org/x/tools/godoc/vfs/mapfs
golang.org/x/tools/godoc/vfs/zipfs
golang.org/x/tools/imports
golang.org/x/tools/playground
golang.org/x/tools/playground/socket
golang.org/x/tools/present
golang.org/x/tools/refactor/eg
golang.org/x/tools/refactor/importgraph
golang.org/x/tools/refactor/rename
golang.org/x/tools/refactor/satisfy
google.golang.org/api/abusiveexperiencereport/v1
google.golang.org/api/acceleratedmobilepageurl/v1
google.golang.org/api/adexchangebuyer/v1.2
google.golang.org/api/adexchangebuyer/v1.3
google.golang.org/api/adexchangebuyer/v1.4
google.golang.org/api/adexchangebuyer2/v2beta1
google.golang.org/api/adexchangeseller/v1
google.golang.org/api/adexchangeseller/v1.1
google.golang.org/api/adexchangeseller/v2.0
google.golang.org/api/adexperiencereport/v1
google.golang.org/api/admin/datatransfer/v1
google.golang.org/api/admin/directory/v1
google.golang.org/api/admin/reports/v1
google.golang.org/api/adsense/v1.3
google.golang.org/api/adsense/v1.4
google.golang.org/api/adsensehost/v4.1
google.golang.org/api/analytics/v2.4
google.golang.org/api/analytics/v3
google.golang.org/api/analyticsreporting/v4
google.golang.org/api/androiddeviceprovisioning/v1
google.golang.org/api/androidenterprise/v1
google.golang.org/api/androidmanagement/v1
google.golang.org/api/androidpublisher/v1
google.golang.org/api/androidpublisher/v1.1
google.golang.org/api/androidpublisher/v2
google.golang.org/api/appengine/v1
google.golang.org/api/appengine/v1alpha
google.golang.org/api/appengine/v1beta
google.golang.org/api/appengine/v1beta4
google.golang.org/api/appengine/v1beta5
google.golang.org/api/appsactivity/v1
google.golang.org/api/appstate/v1
google.golang.org/api/bigquery/v2
google.golang.org/api/bigquerydatatransfer/v1
google.golang.org/api/blogger/v2
google.golang.org/api/blogger/v3
google.golang.org/api/books/v1
google.golang.org/api/calendar/v3
google.golang.org/api/civicinfo/v2
google.golang.org/api/classroom/v1
google.golang.org/api/cloudbilling/v1
google.golang.org/api/cloudbuild/v1
google.golang.org/api/clouddebugger/v2
google.golang.org/api/clouderrorreporting/v1beta1
google.golang.org/api/cloudfunctions/v1
google.golang.org/api/cloudfunctions/v1beta2
google.golang.org/api/cloudiot/v1
google.golang.org/api/cloudiot/v1beta1
google.golang.org/api/cloudkms/v1
google.golang.org/api/cloudmonitoring/v2beta2
google.golang.org/api/cloudresourcemanager/v1
google.golang.org/api/cloudresourcemanager/v1beta1
google.golang.org/api/cloudresourcemanager/v2beta1
google.golang.org/api/cloudshell/v1
google.golang.org/api/cloudshell/v1alpha1
google.golang.org/api/cloudtasks/v2beta2
google.golang.org/api/cloudtrace/v1
google.golang.org/api/cloudtrace/v2
google.golang.org/api/clouduseraccounts/v0.alpha
google.golang.org/api/clouduseraccounts/v0.beta
google.golang.org/api/clouduseraccounts/vm_alpha
google.golang.org/api/clouduseraccounts/vm_beta
google.golang.org/api/compute/v0.alpha
google.golang.org/api/compute/v0.beta
google.golang.org/api/compute/v1
google.golang.org/api/consumersurveys/v2
google.golang.org/api/container/v1
google.golang.org/api/container/v1beta1
google.golang.org/api/content/v2
google.golang.org/api/content/v2sandbox
google.golang.org/api/customsearch/v1
google.golang.org/api/dataflow/v1b3
google.golang.org/api/dataproc/v1
google.golang.org/api/dataproc/v1alpha1
google.golang.org/api/dataproc/v1beta1
google.golang.org/api/dataproc/v1beta2
google.golang.org/api/datastore/v1
google.golang.org/api/datastore/v1beta1
google.golang.org/api/datastore/v1beta3
google.golang.org/api/deploymentmanager/v0.alpha
google.golang.org/api/deploymentmanager/v2
google.golang.org/api/deploymentmanager/v2beta
google.golang.org/api/dfareporting/v2.7
google.golang.org/api/dfareporting/v2.8
google.golang.org/api/dfareporting/v3.0
google.golang.org/api/dialogflow/v2beta1
google.golang.org/api/digitalassetlinks/v1
google.golang.org/api/discovery/v1
google.golang.org/api/dlp/v2beta1
google.golang.org/api/dlp/v2beta2
google.golang.org/api/dns/v1
google.golang.org/api/dns/v1beta2
google.golang.org/api/dns/v2beta1
google.golang.org/api/doubleclickbidmanager/v1
google.golang.org/api/doubleclicksearch/v2
google.golang.org/api/drive/v2
google.golang.org/api/drive/v3
google.golang.org/api/examples
google.golang.org/api/firebasedynamiclinks/v1
google.golang.org/api/firebaseremoteconfig/v1
google.golang.org/api/firebaserules/v1
google.golang.org/api/firestore/v1beta1
google.golang.org/api/fitness/v1
google.golang.org/api/fusiontables/v1
google.golang.org/api/fusiontables/v2
google.golang.org/api/games/v1
google.golang.org/api/gamesconfiguration/v1configuration
google.golang.org/api/gamesmanagement/v1management
google.golang.org/api/genomics/v1
google.golang.org/api/genomics/v1alpha2
google.golang.org/api/gensupport
google.golang.org/api/gmail/v1
google.golang.org/api/google-api-go-generator
google.golang.org/api/google-api-go-generator/internal/disco
google.golang.org/api/googleapi
google.golang.org/api/googleapi/internal/uritemplates
google.golang.org/api/googleapi/transport
google.golang.org/api/groupsmigration/v1
google.golang.org/api/groupssettings/v1
google.golang.org/api/iam/v1
google.golang.org/api/identitytoolkit/v3
google.golang.org/api/internal
google.golang.org/api/iterator
google.golang.org/api/iterator/testing
google.golang.org/api/kgsearch/v1
google.golang.org/api/language/v1
google.golang.org/api/language/v1beta1
google.golang.org/api/language/v1beta2
google.golang.org/api/licensing/v1
google.golang.org/api/logging/v2
google.golang.org/api/logging/v2beta1
google.golang.org/api/manufacturers/v1
google.golang.org/api/mirror/v1
google.golang.org/api/ml/v1
google.golang.org/api/monitoring/v3
google.golang.org/api/oauth2/v1
google.golang.org/api/oauth2/v2
google.golang.org/api/option
google.golang.org/api/oslogin/v1
google.golang.org/api/oslogin/v1alpha
google.golang.org/api/oslogin/v1beta
google.golang.org/api/pagespeedonline/v1
google.golang.org/api/pagespeedonline/v2
google.golang.org/api/partners/v2
google.golang.org/api/people/v1
google.golang.org/api/playcustomapp/v1
google.golang.org/api/playmoviespartner/v1
google.golang.org/api/plus/v1
google.golang.org/api/plusdomains/v1
google.golang.org/api/poly/v1
google.golang.org/api/prediction/v1.2
google.golang.org/api/prediction/v1.3
google.golang.org/api/prediction/v1.4
google.golang.org/api/prediction/v1.5
google.golang.org/api/prediction/v1.6
google.golang.org/api/proximitybeacon/v1beta1
google.golang.org/api/pubsub/v1
google.golang.org/api/pubsub/v1beta1a
google.golang.org/api/pubsub/v1beta2
google.golang.org/api/qpxexpress/v1
google.golang.org/api/replicapool/v1beta1
google.golang.org/api/replicapool/v1beta2
google.golang.org/api/replicapoolupdater/v1beta1
google.golang.org/api/reseller/v1
google.golang.org/api/resourceviews/v1beta1
google.golang.org/api/resourceviews/v1beta2
google.golang.org/api/runtimeconfig/v1
google.golang.org/api/runtimeconfig/v1beta1
google.golang.org/api/safebrowsing/v4
google.golang.org/api/script/v1
google.golang.org/api/searchconsole/v1
google.golang.org/api/serviceconsumermanagement/v1
google.golang.org/api/servicecontrol/v1
google.golang.org/api/servicemanagement/v1
google.golang.org/api/serviceuser/v1
google.golang.org/api/sheets/v4
google.golang.org/api/siteverification/v1
google.golang.org/api/slides/v1
google.golang.org/api/sourcerepo/v1
google.golang.org/api/spanner/v1
google.golang.org/api/spectrum/v1explorer
google.golang.org/api/speech/v1
google.golang.org/api/speech/v1beta1
google.golang.org/api/sqladmin/v1beta3
google.golang.org/api/sqladmin/v1beta4
google.golang.org/api/storage/v1
google.golang.org/api/storage/v1beta1
google.golang.org/api/storage/v1beta2
google.golang.org/api/storagetransfer/v1
google.golang.org/api/streetviewpublish/v1
google.golang.org/api/support/bundler
google.golang.org/api/surveys/v2
google.golang.org/api/tagmanager/v1
google.golang.org/api/tagmanager/v2
google.golang.org/api/taskqueue/v1beta1
google.golang.org/api/taskqueue/v1beta2
google.golang.org/api/tasks/v1
google.golang.org/api/testing/v1
google.golang.org/api/toolresults/v1beta3
google.golang.org/api/toolresults/v1beta3firstparty
google.golang.org/api/tpu/v1alpha1
google.golang.org/api/tracing/v2
google.golang.org/api/translate/v2
google.golang.org/api/transport
google.golang.org/api/transport/bytestream
google.golang.org/api/transport/bytestream/internal
google.golang.org/api/transport/grpc
google.golang.org/api/transport/http
google.golang.org/api/urlshortener/v1
google.golang.org/api/vault/v1
google.golang.org/api/videointelligence/v1beta1
google.golang.org/api/vision/v1
google.golang.org/api/vision/v1p1beta1
google.golang.org/api/webfonts/v1
google.golang.org/api/webmasters/v3
google.golang.org/api/youtube/v3
google.golang.org/api/youtubeanalytics/v1
google.golang.org/api/youtubeanalytics/v1beta1
google.golang.org/api/youtubereporting/v1
google.golang.org/genproto/googleapis/api
google.golang.org/genproto/googleapis/api/annotations
google.golang.org/genproto/googleapis/api/configchange
google.golang.org/genproto/googleapis/api/distribution
google.golang.org/genproto/googleapis/api/httpbody
google.golang.org/genproto/googleapis/api/label
google.golang.org/genproto/googleapis/api/metric
google.golang.org/genproto/googleapis/api/monitoredres
google.golang.org/genproto/googleapis/api/serviceconfig
google.golang.org/genproto/googleapis/api/servicecontrol/v1
google.golang.org/genproto/googleapis/api/servicemanagement/v1
google.golang.org/genproto/googleapis/appengine/legacy
google.golang.org/genproto/googleapis/appengine/logging/v1
google.golang.org/genproto/googleapis/appengine/v1
google.golang.org/genproto/googleapis/assistant/embedded/v1alpha1
google.golang.org/genproto/googleapis/assistant/embedded/v1alpha2
google.golang.org/genproto/googleapis/bigtable/admin/cluster/v1
google.golang.org/genproto/googleapis/bigtable/admin/table/v1
google.golang.org/genproto/googleapis/bigtable/admin/v2
google.golang.org/genproto/googleapis/bigtable/v1
google.golang.org/genproto/googleapis/bigtable/v2
google.golang.org/genproto/googleapis/bytestream
google.golang.org/genproto/googleapis/cloud/audit
google.golang.org/genproto/googleapis/cloud/bigquery/datatransfer/v1
google.golang.org/genproto/googleapis/cloud/bigquery/logging/v1
google.golang.org/genproto/googleapis/cloud/billing/v1
google.golang.org/genproto/googleapis/cloud/dataproc/v1
google.golang.org/genproto/googleapis/cloud/dataproc/v1beta2
google.golang.org/genproto/googleapis/cloud/functions/v1beta2
google.golang.org/genproto/googleapis/cloud/iot/v1
google.golang.org/genproto/googleapis/cloud/language/v1
google.golang.org/genproto/googleapis/cloud/language/v1beta1
google.golang.org/genproto/googleapis/cloud/language/v1beta2
google.golang.org/genproto/googleapis/cloud/location
google.golang.org/genproto/googleapis/cloud/ml/v1
google.golang.org/genproto/googleapis/cloud/ml/v1beta1
google.golang.org/genproto/googleapis/cloud/oslogin/common
google.golang.org/genproto/googleapis/cloud/oslogin/v1alpha
google.golang.org/genproto/googleapis/cloud/oslogin/v1beta
google.golang.org/genproto/googleapis/cloud/resourcemanager/v2
google.golang.org/genproto/googleapis/cloud/runtimeconfig/v1beta1
google.golang.org/genproto/googleapis/cloud/speech/v1
google.golang.org/genproto/googleapis/cloud/speech/v1beta1
google.golang.org/genproto/googleapis/cloud/speech/v1p1beta1
google.golang.org/genproto/googleapis/cloud/support/common
google.golang.org/genproto/googleapis/cloud/support/v1alpha1
google.golang.org/genproto/googleapis/cloud/videointelligence/v1
google.golang.org/genproto/googleapis/cloud/videointelligence/v1beta1
google.golang.org/genproto/googleapis/cloud/videointelligence/v1beta2
google.golang.org/genproto/googleapis/cloud/vision/v1
google.golang.org/genproto/googleapis/cloud/vision/v1p1beta1
google.golang.org/genproto/googleapis/container/v1
google.golang.org/genproto/googleapis/container/v1alpha1
google.golang.org/genproto/googleapis/container/v1beta1
google.golang.org/genproto/googleapis/datastore/admin/v1beta1
google.golang.org/genproto/googleapis/datastore/v1
google.golang.org/genproto/googleapis/datastore/v1beta3
google.golang.org/genproto/googleapis/devtools/build/v1
google.golang.org/genproto/googleapis/devtools/cloudbuild/v1
google.golang.org/genproto/googleapis/devtools/clouddebugger/v2
google.golang.org/genproto/googleapis/devtools/clouderrorreporting/v1beta1
google.golang.org/genproto/googleapis/devtools/cloudprofiler/v2
google.golang.org/genproto/googleapis/devtools/cloudtrace/v1
google.golang.org/genproto/googleapis/devtools/cloudtrace/v2
google.golang.org/genproto/googleapis/devtools/containeranalysis/v1alpha1
google.golang.org/genproto/googleapis/devtools/remoteexecution/v1test
google.golang.org/genproto/googleapis/devtools/source/v1
google.golang.org/genproto/googleapis/devtools/sourcerepo/v1
google.golang.org/genproto/googleapis/example/library/v1
google.golang.org/genproto/googleapis/firestore/admin/v1beta1
google.golang.org/genproto/googleapis/firestore/v1beta1
google.golang.org/genproto/googleapis/genomics/v1
google.golang.org/genproto/googleapis/genomics/v1alpha2
google.golang.org/genproto/googleapis/iam/admin/v1
google.golang.org/genproto/googleapis/iam/v1
google.golang.org/genproto/googleapis/iam/v1/logging
google.golang.org/genproto/googleapis/logging/type
google.golang.org/genproto/googleapis/logging/v2
google.golang.org/genproto/googleapis/longrunning
google.golang.org/genproto/googleapis/monitoring/v3
google.golang.org/genproto/googleapis/privacy/dlp/v2beta1
google.golang.org/genproto/googleapis/pubsub/v1
google.golang.org/genproto/googleapis/pubsub/v1beta2
google.golang.org/genproto/googleapis/rpc/code
google.golang.org/genproto/googleapis/rpc/errdetails
google.golang.org/genproto/googleapis/rpc/status
google.golang.org/genproto/googleapis/spanner/admin/database/v1
google.golang.org/genproto/googleapis/spanner/admin/instance/v1
google.golang.org/genproto/googleapis/spanner/v1
google.golang.org/genproto/googleapis/storagetransfer/v1
google.golang.org/genproto/googleapis/streetview/publish/v1
google.golang.org/genproto/googleapis/tracing/v1
google.golang.org/genproto/googleapis/type/color
google.golang.org/genproto/googleapis/type/date
google.golang.org/genproto/googleapis/type/dayofweek
google.golang.org/genproto/googleapis/type/latlng
google.golang.org/genproto/googleapis/type/money
google.golang.org/genproto/googleapis/type/postaladdress
google.golang.org/genproto/googleapis/type/timeofday
google.golang.org/genproto/googleapis/watcher/v1
google.golang.org/genproto/protobuf/api
google.golang.org/genproto/protobuf/field_mask
google.golang.org/genproto/protobuf/ptype
google.golang.org/genproto/protobuf/source_context
google.golang.org/grpc
google.golang.org/grpc/balancer
google.golang.org/grpc/balancer/base
google.golang.org/grpc/balancer/roundrobin
google.golang.org/grpc/benchmark
google.golang.org/grpc/benchmark/benchmain
google.golang.org/grpc/benchmark/benchresult
google.golang.org/grpc/benchmark/client
google.golang.org/grpc/benchmark/grpc_testing
google.golang.org/grpc/benchmark/latency
google.golang.org/grpc/benchmark/primitives
google.golang.org/grpc/benchmark/server
google.golang.org/grpc/benchmark/stats
google.golang.org/grpc/benchmark/worker
google.golang.org/grpc/codes
google.golang.org/grpc/connectivity
google.golang.org/grpc/credentials
google.golang.org/grpc/credentials/oauth
google.golang.org/grpc/encoding
google.golang.org/grpc/encoding/gzip
google.golang.org/grpc/examples/helloworld/greeter_client
google.golang.org/grpc/examples/helloworld/greeter_server
google.golang.org/grpc/examples/helloworld/helloworld
google.golang.org/grpc/examples/helloworld/mock_helloworld
google.golang.org/grpc/examples/route_guide/client
google.golang.org/grpc/examples/route_guide/mock_routeguide
google.golang.org/grpc/examples/route_guide/routeguide
google.golang.org/grpc/examples/route_guide/server
google.golang.org/grpc/grpclb
google.golang.org/grpc/grpclb/grpc_lb_v1/messages
google.golang.org/grpc/grpclb/grpc_lb_v1/service
google.golang.org/grpc/grpclog
google.golang.org/grpc/grpclog/glogger
google.golang.org/grpc/health
google.golang.org/grpc/health/grpc_health_v1
google.golang.org/grpc/internal
google.golang.org/grpc/interop
google.golang.org/grpc/interop/client
google.golang.org/grpc/interop/grpc_testing
google.golang.org/grpc/interop/http2
google.golang.org/grpc/interop/server
google.golang.org/grpc/keepalive
google.golang.org/grpc/metadata
google.golang.org/grpc/naming
google.golang.org/grpc/peer
google.golang.org/grpc/reflection
google.golang.org/grpc/reflection/grpc_reflection_v1alpha
google.golang.org/grpc/reflection/grpc_testing
google.golang.org/grpc/reflection/grpc_testingv3
google.golang.org/grpc/resolver
google.golang.org/grpc/resolver/dns
google.golang.org/grpc/resolver/manual
google.golang.org/grpc/resolver/passthrough
google.golang.org/grpc/stats
google.golang.org/grpc/stats/grpc_testing
google.golang.org/grpc/status
google.golang.org/grpc/stress/client
google.golang.org/grpc/stress/grpc_testing
google.golang.org/grpc/stress/metrics_client
google.golang.org/grpc/tap
google.golang.org/grpc/test
google.golang.org/grpc/test/bufconn
google.golang.org/grpc/test/codec_perf
google.golang.org/grpc/test/grpc_testing
google.golang.org/grpc/test/leakcheck
google.golang.org/grpc/transport
gopkg.in/alecthomas/kingpin.v2
gopkg.in/alecthomas/kingpin.v2/cmd/genvalues
gopkg.in/alecthomas/kingpin.v3-unstable
gopkg.in/alecthomas/kingpin.v3-unstable/cmd/embedi18n
gopkg.in/alecthomas/kingpin.v3-unstable/cmd/genvalues
gopkg.in/dancannon/gorethink.v2
gopkg.in/dancannon/gorethink.v2/encoding
gopkg.in/dancannon/gorethink.v2/internal/compare
gopkg.in/dancannon/gorethink.v2/internal/reql_tests
gopkg.in/dancannon/gorethink.v2/ql2
gopkg.in/dancannon/gorethink.v2/types
gopkg.in/fatih/pool.v2
gopkg.in/fsnotify.v1
gopkg.in/gorp.v1
gopkg.in/jcmturner/aescts.v1
gopkg.in/jcmturner/dnsutils.v1
gopkg.in/jcmturner/gokrb5.v2/asn1tools
gopkg.in/jcmturner/gokrb5.v2/client
gopkg.in/jcmturner/gokrb5.v2/config
gopkg.in/jcmturner/gokrb5.v2/credentials
gopkg.in/jcmturner/gokrb5.v2/crypto
gopkg.in/jcmturner/gokrb5.v2/crypto/common
gopkg.in/jcmturner/gokrb5.v2/crypto/etype
gopkg.in/jcmturner/gokrb5.v2/crypto/rfc3961
gopkg.in/jcmturner/gokrb5.v2/crypto/rfc3962
gopkg.in/jcmturner/gokrb5.v2/crypto/rfc4757
gopkg.in/jcmturner/gokrb5.v2/crypto/rfc8009
gopkg.in/jcmturner/gokrb5.v2/gssapi
gopkg.in/jcmturner/gokrb5.v2/iana
gopkg.in/jcmturner/gokrb5.v2/iana/adtype
gopkg.in/jcmturner/gokrb5.v2/iana/asnAppTag
gopkg.in/jcmturner/gokrb5.v2/iana/chksumtype
gopkg.in/jcmturner/gokrb5.v2/iana/errorcode
gopkg.in/jcmturner/gokrb5.v2/iana/etypeID
gopkg.in/jcmturner/gokrb5.v2/iana/flags
gopkg.in/jcmturner/gokrb5.v2/iana/keyusage
gopkg.in/jcmturner/gokrb5.v2/iana/msgtype
gopkg.in/jcmturner/gokrb5.v2/iana/nametype
gopkg.in/jcmturner/gokrb5.v2/iana/patype
gopkg.in/jcmturner/gokrb5.v2/keytab
gopkg.in/jcmturner/gokrb5.v2/krberror
gopkg.in/jcmturner/gokrb5.v2/messages
gopkg.in/jcmturner/gokrb5.v2/mstypes
gopkg.in/jcmturner/gokrb5.v2/ndr
gopkg.in/jcmturner/gokrb5.v2/pac
gopkg.in/jcmturner/gokrb5.v2/service
gopkg.in/jcmturner/gokrb5.v2/types
gopkg.in/jmcvetta/napping.v2
gopkg.in/jmcvetta/napping.v2/examples/github_auth_token
gopkg.in/jmcvetta/napping.v2/examples/httpbin
gopkg.in/libgit2/git2go.v25
gopkg.in/linkedin/goavro.v1
gopkg.in/linkedin/goavro.v1/examples/arrayRecordField
gopkg.in/linkedin/goavro.v1/examples/arraySimpleField
gopkg.in/linkedin/goavro.v1/examples/blocktick
gopkg.in/linkedin/goavro.v1/examples/bufferedEncoder
gopkg.in/linkedin/goavro.v1/examples/decodeRecord
gopkg.in/linkedin/goavro.v1/examples/encodeRecord
gopkg.in/linkedin/goavro.v1/examples/fileReader
gopkg.in/linkedin/goavro.v1/examples/fileWriter
gopkg.in/linkedin/goavro.v1/examples/generic_datum
gopkg.in/linkedin/goavro.v1/examples/mapSimpleField
gopkg.in/linkedin/goavro.v1/examples/nestedRecords
gopkg.in/linkedin/goavro.v1/examples/net/client
gopkg.in/linkedin/goavro.v1/examples/net/server
gopkg.in/mailgun/mailgun-go.v1
gopkg.in/mailgun/mailgun-go.v1/cmd/mailgun
gopkg.in/mgo.v2
gopkg.in/mgo.v2/bson
gopkg.in/mgo.v2/dbtest
gopkg.in/mgo.v2/internal/json
gopkg.in/mgo.v2/internal/sasl
gopkg.in/mgo.v2/internal/scram
gopkg.in/mgo.v2/txn
gopkg.in/natefinch/lumberjack.v2
gopkg.in/rana/ora.v4
gopkg.in/rana/ora.v4/date
gopkg.in/rana/ora.v4/examples/bench
gopkg.in/rana/ora.v4/examples/bench/oci8
gopkg.in/rana/ora.v4/examples/bench/ora
gopkg.in/rana/ora.v4/examples/connect
gopkg.in/rana/ora.v4/examples/conntest
gopkg.in/rana/ora.v4/examples/csvdump
gopkg.in/rana/ora.v4/examples/csvload
gopkg.in/rana/ora.v4/glg
gopkg.in/rana/ora.v4/lg
gopkg.in/rana/ora.v4/lg15
gopkg.in/rana/ora.v4/num
gopkg.in/rana/ora.v4/tstlg
gopkg.in/redis.v5
gopkg.in/redis.v5/internal
gopkg.in/redis.v5/internal/consistenthash
gopkg.in/redis.v5/internal/hashtag
gopkg.in/redis.v5/internal/pool
gopkg.in/redis.v5/internal/proto
gopkg.in/square/go-jose.v1
gopkg.in/square/go-jose.v1/cipher
gopkg.in/square/go-jose.v1/jose-util
gopkg.in/square/go-jose.v1/json
gopkg.in/urfave/cli.v1
gopkg.in/urfave/cli.v1/altsrc
gopkg.in/urfave/cli.v2
gopkg.in/urfave/cli.v2/altsrc
gopkg.in/vmihailenco/msgpack.v2
gopkg.in/vmihailenco/msgpack.v2/codes
gopkg.in/yaml.v1
gopkg.in/yaml.v2
grift.build/94a4736266
grift.build/94a4736266/grifts
grift.build/b98da0645e
grift.build/b98da0645e/grifts
honnef.co/go/js/dom
honnef.co/go/tools/callgraph
honnef.co/go/tools/callgraph/cha
honnef.co/go/tools/callgraph/rta
honnef.co/go/tools/callgraph/static
honnef.co/go/tools/cmd/errcheck-ng
honnef.co/go/tools/cmd/gosimple
honnef.co/go/tools/cmd/keyify
honnef.co/go/tools/cmd/megacheck
honnef.co/go/tools/cmd/rdeps
honnef.co/go/tools/cmd/staticcheck
honnef.co/go/tools/cmd/structlayout
honnef.co/go/tools/cmd/structlayout-optimize
honnef.co/go/tools/cmd/structlayout-pretty
honnef.co/go/tools/cmd/unused
honnef.co/go/tools/deprecated
honnef.co/go/tools/errcheck
honnef.co/go/tools/functions
honnef.co/go/tools/gcsizes
honnef.co/go/tools/internal/sharedcheck
honnef.co/go/tools/lint
honnef.co/go/tools/lint/lintutil
honnef.co/go/tools/lint/testutil
honnef.co/go/tools/simple
honnef.co/go/tools/ssa
honnef.co/go/tools/ssa/ssautil
honnef.co/go/tools/staticcheck
honnef.co/go/tools/staticcheck/vrp
honnef.co/go/tools/structlayout
honnef.co/go/tools/unused
honnef.co/go/tools/version
jrubin.io/zb
jrubin.io/zb/cmd
jrubin.io/zb/cmd/build
jrubin.io/zb/cmd/clean
jrubin.io/zb/cmd/commands
jrubin.io/zb/cmd/complete
jrubin.io/zb/cmd/install
jrubin.io/zb/cmd/lint
jrubin.io/zb/cmd/list
jrubin.io/zb/cmd/test
jrubin.io/zb/cmd/version
jrubin.io/zb/lib/buildflags
jrubin.io/zb/lib/dag
jrubin.io/zb/lib/dependency
jrubin.io/zb/lib/ellipsis
jrubin.io/zb/lib/lintflags
jrubin.io/zb/lib/project
jrubin.io/zb/lib/zbcontext
jrubin.io/zb/lib/zblint
jrubin.io/zb/lib/zbtest
mvdan.cc/lint
mvdan.cc/lint/cmd/metalint
mvdan.cc/sh/cmd/gosh
mvdan.cc/sh/cmd/shfmt
mvdan.cc/sh/fileutil
mvdan.cc/sh/interp
mvdan.cc/sh/shell
mvdan.cc/sh/syntax
periph.io/x/periph
periph.io/x/periph/cmd/apa102
periph.io/x/periph/cmd/bmxx80
periph.io/x/periph/cmd/gpio-list
periph.io/x/periph/cmd/gpio-read
periph.io/x/periph/cmd/gpio-write
periph.io/x/periph/cmd/headers-list
periph.io/x/periph/cmd/i2c-io
periph.io/x/periph/cmd/i2c-list
periph.io/x/periph/cmd/ir
periph.io/x/periph/cmd/led
periph.io/x/periph/cmd/lepton
periph.io/x/periph/cmd/onewire-list
periph.io/x/periph/cmd/periph-info
periph.io/x/periph/cmd/periph-smoketest
periph.io/x/periph/cmd/spi-io
periph.io/x/periph/cmd/spi-list
periph.io/x/periph/cmd/ssd1306
periph.io/x/periph/cmd/thermal
periph.io/x/periph/cmd/tm1637
periph.io/x/periph/conn
periph.io/x/periph/conn/conntest
periph.io/x/periph/conn/gpio
periph.io/x/periph/conn/gpio/gpioreg
periph.io/x/periph/conn/gpio/gpiosmoketest
periph.io/x/periph/conn/gpio/gpiostream
periph.io/x/periph/conn/gpio/gpiostream/gpiostreamtest
periph.io/x/periph/conn/gpio/gpiotest
periph.io/x/periph/conn/i2c
periph.io/x/periph/conn/i2c/i2creg
periph.io/x/periph/conn/i2c/i2csmoketest
periph.io/x/periph/conn/i2c/i2ctest
periph.io/x/periph/conn/ir
periph.io/x/periph/conn/mmr
periph.io/x/periph/conn/onewire
periph.io/x/periph/conn/onewire/onewirereg
periph.io/x/periph/conn/onewire/onewiresmoketest
periph.io/x/periph/conn/onewire/onewiretest
periph.io/x/periph/conn/pin
periph.io/x/periph/conn/pin/pinreg
periph.io/x/periph/conn/spi
periph.io/x/periph/conn/spi/spireg
periph.io/x/periph/conn/spi/spismoketest
periph.io/x/periph/conn/spi/spitest
periph.io/x/periph/devices
periph.io/x/periph/devices/apa102
periph.io/x/periph/devices/bmxx80
periph.io/x/periph/devices/bmxx80/bmx280smoketest
periph.io/x/periph/devices/devicestest
periph.io/x/periph/devices/ds18b20
periph.io/x/periph/devices/ds248x
periph.io/x/periph/devices/lepton
periph.io/x/periph/devices/lepton/cci
periph.io/x/periph/devices/lepton/internal
periph.io/x/periph/devices/lirc
periph.io/x/periph/devices/ssd1306
periph.io/x/periph/devices/ssd1306/image1bit
periph.io/x/periph/devices/ssd1306/ssd1306smoketest
periph.io/x/periph/devices/tm1637
periph.io/x/periph/experimental/cmd/cap1188
periph.io/x/periph/experimental/cmd/nrzled
periph.io/x/periph/experimental/conn/analog
periph.io/x/periph/experimental/conn/uart
periph.io/x/periph/experimental/conn/uart/uartreg
periph.io/x/periph/experimental/devices/bitbang
periph.io/x/periph/experimental/devices/cap1188
periph.io/x/periph/experimental/devices/nrzled
periph.io/x/periph/experimental/devices/piblaster
periph.io/x/periph/experimental/driverskeleton
periph.io/x/periph/experimental/host/am335x
periph.io/x/periph/experimental/host/beagle
periph.io/x/periph/experimental/host/pru
periph.io/x/periph/experimental/host/sysfs
periph.io/x/periph/host
periph.io/x/periph/host/allwinner
periph.io/x/periph/host/allwinner/allwinnersmoketest
periph.io/x/periph/host/bcm283x
periph.io/x/periph/host/bcm283x/bcm283xsmoketest
periph.io/x/periph/host/chip
periph.io/x/periph/host/chip/chipsmoketest
periph.io/x/periph/host/cpu
periph.io/x/periph/host/distro
periph.io/x/periph/host/fs
periph.io/x/periph/host/odroidc1
periph.io/x/periph/host/odroidc1/odroidc1smoketest
periph.io/x/periph/host/pine64
periph.io/x/periph/host/pmem
periph.io/x/periph/host/rpi
periph.io/x/periph/host/sysfs
periph.io/x/periph/host/sysfs/sysfssmoketest
periph.io/x/periph/host/videocore
sourcegraph.com/sourcegraph/go-diff/cmd/go-diff
sourcegraph.com/sourcegraph/go-diff/diff
sourcegraph.com/sqs/goreturns
sourcegraph.com/sqs/goreturns/returns
sourcegraph.com/sqs/pbtypes
upspin.io/access
upspin.io/bind
upspin.io/cache
upspin.io/client
upspin.io/client/clientutil
upspin.io/client/file
upspin.io/cloud/https
upspin.io/cloud/mail
upspin.io/cloud/mail/sendgrid
upspin.io/cloud/storage
upspin.io/cloud/storage/disk
upspin.io/cloud/storage/disk/internal/local
upspin.io/cloud/storage/storagetest
upspin.io/cmd/cacheserver
upspin.io/cmd/cacheserver/cacheutil
upspin.io/cmd/dirserver
upspin.io/cmd/frontend
upspin.io/cmd/keyserver
upspin.io/cmd/storeserver
upspin.io/cmd/upbox
upspin.io/cmd/upspin
upspin.io/cmd/upspin-audit
upspin.io/cmd/upspin-setupstorage
upspin.io/cmd/upspinfs
upspin.io/cmd/upspinfs/internal/ose
upspin.io/cmd/upspinserver
upspin.io/config
upspin.io/dir/dircache
upspin.io/dir/inprocess
upspin.io/dir/remote
upspin.io/dir/server
upspin.io/dir/server/serverlog
upspin.io/dir/server/tree
upspin.io/dir/unassigned
upspin.io/errors
upspin.io/factotum
upspin.io/flags
upspin.io/key/inprocess
upspin.io/key/keygen
upspin.io/key/proquint
upspin.io/key/remote
upspin.io/key/server
upspin.io/key/sha256key
upspin.io/key/transports
upspin.io/key/unassigned
upspin.io/key/usercache
upspin.io/log
upspin.io/metric
upspin.io/pack
upspin.io/pack/ee
upspin.io/pack/eeintegrity
upspin.io/pack/internal
upspin.io/pack/internal/packtest
upspin.io/pack/packutil
upspin.io/pack/plain
upspin.io/path
upspin.io/rpc
upspin.io/rpc/dirserver
upspin.io/rpc/keyserver
upspin.io/rpc/local
upspin.io/rpc/storeserver
upspin.io/serverutil
upspin.io/serverutil/dirserver
upspin.io/serverutil/frontend
upspin.io/serverutil/keyserver
upspin.io/serverutil/perm
upspin.io/serverutil/signup
upspin.io/serverutil/storeserver
upspin.io/serverutil/upspinserver
upspin.io/serverutil/web
upspin.io/shutdown
upspin.io/store/inprocess
upspin.io/store/remote
upspin.io/store/server
upspin.io/store/storecache
upspin.io/store/transports
upspin.io/store/unassigned
upspin.io/subcmd
upspin.io/test
upspin.io/test/servermux
upspin.io/test/testenv
upspin.io/test/testfixtures
upspin.io/test/testutil
upspin.io/transports
upspin.io/upbox
upspin.io/upspin
upspin.io/upspin/proto
upspin.io/user
upspin.io/valid
upspin.io/version
zombiezen.com/go/capnproto2
zombiezen.com/go/capnproto2/capnpc-go
zombiezen.com/go/capnproto2/encoding/text
zombiezen.com/go/capnproto2/internal/aircraftlib
zombiezen.com/go/capnproto2/internal/capnptool
zombiezen.com/go/capnproto2/internal/demo
zombiezen.com/go/capnproto2/internal/demo/books
zombiezen.com/go/capnproto2/internal/demo/hashes
zombiezen.com/go/capnproto2/internal/fulfiller
zombiezen.com/go/capnproto2/internal/nodemap
zombiezen.com/go/capnproto2/internal/packed
zombiezen.com/go/capnproto2/internal/queue
zombiezen.com/go/capnproto2/internal/schema
zombiezen.com/go/capnproto2/internal/strquote
zombiezen.com/go/capnproto2/pogs
zombiezen.com/go/capnproto2/rpc
zombiezen.com/go/capnproto2/rpc/internal/logtransport
zombiezen.com/go/capnproto2/rpc/internal/logutil
zombiezen.com/go/capnproto2/rpc/internal/pipetransport
zombiezen.com/go/capnproto2/rpc/internal/refcount
zombiezen.com/go/capnproto2/rpc/internal/testcapnp
zombiezen.com/go/capnproto2/schemas
zombiezen.com/go/capnproto2/server
zombiezen.com/go/capnproto2/std/capnp/cxx
zombiezen.com/go/capnproto2/std/capnp/json
zombiezen.com/go/capnproto2/std/capnp/persistent
zombiezen.com/go/capnproto2/std/capnp/rpc
zombiezen.com/go/capnproto2/std/capnp/rpctwoparty
zombiezen.com/go/capnproto2/std/capnp/schema
Go-Package-Store
	up to date: github.com/shurcooL/Go-Package-Store/cmd/Go-Package-Store
Heartbleed
	up to date: github.com/FiloSottile/Heartbleed
agg
	up to date: github.com/kr/text/cmd/agg
	up to date: github.com/maruel/panicparse/vendor/github.com/kr/text/cmd/agg
	up to date: github.com/workfit/tester/vendor/github.com/kr/text/cmd/agg
aligncheck
	(no source package found)
apa102
	up to date: periph.io/x/periph/cmd/apa102
archiver
	stale: github.com/mholt/archiver/cmd/archiver (stale dependency)
asmfmt
	up to date: github.com/klauspost/asmfmt/cmd/asmfmt
aws-sam-local
	up to date: github.com/awslabs/aws-sam-local
becca
	up to date: github.com/dave/rebecca/cmd/becca
	up to date: github.com/davelondon/rebecca/cmd/becca
benchcmp
	stale: github.com/davidrjenni/reftools/vendor/golang.org/x/tools/cmd/benchcmp (build ID mismatch)
	up to date: golang.org/x/tools/cmd/benchcmp
binstale
	up to date: github.com/shurcooL/binstale
bme280
	(no source package found)
buffalo
	stale: github.com/gobuffalo/buffalo/buffalo (build ID mismatch)
	stale: github.com/klauern/adr_web/vendor/github.com/gobuffalo/buffalo/buffalo (build ID mismatch)
	stale: github.com/klauern/shellchecker/vendor/github.com/gobuffalo/buffalo/buffalo (build ID mismatch)
buffered-read-benchmark
	stale: github.com/digitalocean/doctl/vendor/github.com/pkg/sftp/examples/buffered-read-benchmark (build ID mismatch)
	stale: github.com/hashicorp/packer/vendor/github.com/pkg/sftp/examples/buffered-read-benchmark (build ID mismatch)
	stale: github.com/mitchellh/packer/vendor/github.com/pkg/sftp/examples/buffered-read-benchmark (build ID mismatch)
	stale: github.com/pkg/sftp/examples/buffered-read-benchmark (stale dependency)
buffered-write-benchmark
	stale: github.com/digitalocean/doctl/vendor/github.com/pkg/sftp/examples/buffered-write-benchmark (build ID mismatch)
	stale: github.com/hashicorp/packer/vendor/github.com/pkg/sftp/examples/buffered-write-benchmark (build ID mismatch)
	stale: github.com/mitchellh/packer/vendor/github.com/pkg/sftp/examples/buffered-write-benchmark (build ID mismatch)
	stale: github.com/pkg/sftp/examples/buffered-write-benchmark (stale dependency)
bundle
	stale: github.com/davidrjenni/reftools/vendor/golang.org/x/tools/cmd/bundle (build ID mismatch)
	up to date: golang.org/x/tools/cmd/bundle
cacheserver
	up to date: upspin.io/cmd/cacheserver
caddy
	up to date: github.com/mholt/caddy/caddy
callgraph
	stale: github.com/davidrjenni/reftools/vendor/golang.org/x/tools/cmd/callgraph (build ID mismatch)
	up to date: golang.org/x/tools/cmd/callgraph
certigo
	up to date: github.com/square/certigo
cfssl
	up to date: github.com/cloudflare/cfssl/cmd/cfssl
chidley
	up to date: github.com/gnewton/chidley
cmd
	stale: cloud.google.com/go/pubsub/loadtest/cmd (build ID mismatch)
	stale: github.com/Azure/go-autorest/autorest/adal/cmd (build ID mismatch)
	stale: github.com/derekparker/delve/service/test/cmd (build ID mismatch)
	stale: github.com/docker/docker-credential-helpers/pass/cmd (build ID mismatch)
	stale: github.com/docker/docker-credential-helpers/secretservice/cmd (build ID mismatch)
	stale: github.com/docker/machine/cmd (build ID mismatch)
	stale: github.com/go-siris/siris/vendor/github.com/pelletier/go-toml/cmd (build ID mismatch)
	stale: github.com/klauern/adr_web/vendor/github.com/pelletier/go-toml/cmd (build ID mismatch)
	stale: github.com/klauern/osb-lint/cmd (build ID mismatch)
	stale: github.com/klauern/rollin_dollas/cmd (build ID mismatch)
	stale: github.com/klauern/tunnellergy/vendor/github.com/pelletier/go-toml/cmd (build ID mismatch)
	stale: github.com/marshallbrekka/go-u2fhost/cmd (build ID mismatch)
	up to date: github.com/pelletier/go-toml/cmd
	stale: go.mozilla.org/sops/vendor/cloud.google.com/go/pubsub/loadtest/cmd (build ID mismatch)
coa
	up to date: github.com/asciimoo/coa
cobra
	stale: github.com/digitalocean/doctl/vendor/github.com/spf13/cobra/cobra (build ID mismatch)
	stale: github.com/klauern/tunnellergy/vendor/github.com/spf13/cobra/cobra (build ID mismatch)
	up to date: github.com/spf13/cobra/cobra
coke
	stale: github.com/klauern/coke (build ID mismatch)
colcmp
	stale: github.com/digitalocean/doctl/vendor/golang.org/x/text/collate/tools/colcmp (build ID mismatch)
	stale: github.com/go-siris/siris/vendor/golang.org/x/text/collate/tools/colcmp (build ID mismatch)
	stale: github.com/klauern/tunnellergy/vendor/golang.org/x/text/collate/tools/colcmp (build ID mismatch)
	stale: github.com/kotakanbe/go-cve-dictionary/vendor/golang.org/x/text/collate/tools/colcmp (build ID mismatch)
	stale: go.mozilla.org/sops/vendor/golang.org/x/text/collate/tools/colcmp (build ID mismatch)
	up to date: golang.org/x/text/collate/tools/colcmp
cover
	stale: github.com/davidrjenni/reftools/vendor/golang.org/x/tools/cmd/cover (build ID mismatch)
	up to date: golang.org/x/tools/cmd/cover
deadcode
	(no source package found)
dep
	up to date: github.com/golang/dep/cmd/dep
digraph
	up to date: github.com/davidrjenni/reftools/vendor/golang.org/x/tools/cmd/digraph
	up to date: golang.org/x/tools/cmd/digraph
dirserver
	up to date: upspin.io/cmd/dirserver
dlv
	up to date: github.com/derekparker/delve/cmd/dlv
docker
	up to date: github.com/docker/cli/cmd/docker
	stale: github.com/klauern/oldgojenkins/vendor/github.com/docker/docker/cmd/docker (build ID mismatch)
	stale: github.com/klauern/oldgojenkins/vendor/github.com/moby/moby/cmd/docker (build ID mismatch)
dorepl
	up to date: github.com/aybabtme/godotto/cmd/dorepl
dupl
	(no source package found)
duplicacy
	stale: github.com/gilbertchen/duplicacy/duplicacy (build ID mismatch)
eg
	stale: github.com/davidrjenni/reftools/vendor/golang.org/x/tools/cmd/eg (build ID mismatch)
	up to date: golang.org/x/tools/cmd/eg
errcheck
	up to date: github.com/kisielk/errcheck
fac
	up to date: github.com/mkchoi212/fac
fillstruct
	up to date: github.com/davidrjenni/reftools/cmd/fillstruct
fiximports
	up to date: github.com/davidrjenni/reftools/vendor/golang.org/x/tools/cmd/fiximports
	up to date: golang.org/x/tools/cmd/fiximports
frontend
	stale: github.com/shurcooL/Go-Package-Store/frontend (build ID mismatch)
	up to date: upspin.io/cmd/frontend
fwauth
	(no source package found)
gas
	(no source package found)
gb
	up to date: github.com/constabulary/gb/cmd/gb
gb-vendor
	stale: github.com/constabulary/gb/cmd/gb-vendor (build ID mismatch)
gdlv
	up to date: github.com/aarzilli/gdlv
ginkgo
	up to date: github.com/onsi/ginkgo/ginkgo
	stale: go.mozilla.org/sops/vendor/github.com/onsi/ginkgo/ginkgo (build ID mismatch)
git-codereview
	up to date: golang.org/x/review/git-codereview
glide
	up to date: github.com/Masterminds/glide
go-adr
	(no source package found)
go-bindata
	up to date: github.com/jteeuwen/go-bindata/go-bindata
go-buildrun
	up to date: github.com/metaleap/go-buildrun
go-cve-dictionary
	stale: github.com/kotakanbe/go-cve-dictionary (build ID mismatch)
go-langserver
	up to date: github.com/sourcegraph/go-langserver
go-outline
	up to date: github.com/lukehoban/go-outline
	stale: github.com/ramya-rao-a/go-outline (build ID mismatch)
go-pry
	up to date: github.com/d4l3k/go-pry
go-symbols
	up to date: github.com/acroca/go-symbols
	up to date: github.com/newhook/go-symbols
go1.8rc2
	up to date: golang.org/x/build/version/go1.8rc2
gocode
	up to date: github.com/nsf/gocode
gocomplete
	up to date: github.com/posener/complete/gocomplete
goconst
	(no source package found)
goconvey
	up to date: github.com/smartystreets/goconvey
	stale: go.mozilla.org/sops/vendor/github.com/smartystreets/goconvey (build ID mismatch)
gocyclo
	(no source package found)
godef
	up to date: github.com/rogpeppe/godef
godepgraph
	up to date: github.com/kisielk/godepgraph
godex
	up to date: github.com/davidrjenni/reftools/vendor/golang.org/x/tools/cmd/godex
	up to date: golang.org/x/tools/cmd/godex
godoc
	stale: github.com/davidrjenni/reftools/vendor/golang.org/x/tools/cmd/godoc (build ID mismatch)
	up to date: golang.org/x/tools/cmd/godoc
godoctor
	up to date: github.com/godoctor/godoctor
gogetdoc
	up to date: github.com/zmb3/gogetdoc
gogi
	up to date: github.com/Gnouc/gogi/cmd/gogi
gogs
	up to date: github.com/gogits/gogs
goimports
	stale: github.com/davidrjenni/reftools/vendor/golang.org/x/tools/cmd/goimports (build ID mismatch)
	stale: github.com/klauspost/asmfmt/cmd/goimports (build ID mismatch)
	up to date: golang.org/x/tools/cmd/goimports
golint
	up to date: github.com/360EntSecGroup-Skylar/goreporter/linters/golint/golint
	up to date: github.com/golang/lint/golint
	up to date: github.com/wgliang/goreporter/linters/golint/golint
goman
	up to date: github.com/christophberger/goman
gometalinter
	up to date: github.com/alecthomas/gometalinter
gomodifytags
	up to date: github.com/fatih/gomodifytags
gomvpkg
	stale: github.com/davidrjenni/reftools/vendor/golang.org/x/tools/cmd/gomvpkg (build ID mismatch)
	up to date: golang.org/x/tools/cmd/gomvpkg
gopass
	up to date: github.com/justwatchcom/gopass
gopherci
	stale: github.com/bradleyfalzon/gopherci (build ID mismatch)
gopherjs
	up to date: github.com/gopherjs/gopherjs
	stale: go.mozilla.org/sops/vendor/github.com/gopherjs/gopherjs (build ID mismatch)
gopkgs
	stale: github.com/haya14busa/gopkgs/cmd/gopkgs (build ID mismatch)
	stale: github.com/tpng/gopkgs (build ID mismatch)
	up to date: github.com/uudashr/gopkgs/cmd/gopkgs
goplay
	up to date: github.com/haya14busa/goplay/cmd/goplay
gore
	up to date: github.com/motemen/gore
gorebuild
	up to date: github.com/FiloSottile/gorebuild
goreleaser
	up to date: github.com/goreleaser/goreleaser
gorename
	stale: github.com/davidrjenni/reftools/vendor/golang.org/x/tools/cmd/gorename (build ID mismatch)
	up to date: golang.org/x/tools/cmd/gorename
goreporter
	up to date: github.com/360EntSecGroup-Skylar/goreporter
	up to date: github.com/wgliang/goreporter
goreturns
	stale: github.com/klauspost/asmfmt/cmd/goreturns (build ID mismatch)
	up to date: github.com/sqs/goreturns
	up to date: sourcegraph.com/sqs/goreturns
gosimple
	up to date: honnef.co/go/tools/cmd/gosimple
gostatus
	up to date: github.com/shurcooL/gostatus
gotags
	up to date: github.com/jstemmer/gotags
gotests
	up to date: github.com/cweill/gotests/gotests
gotext
	stale: github.com/go-siris/siris/vendor/golang.org/x/text/cmd/gotext (build ID mismatch)
	stale: github.com/klauern/tunnellergy/vendor/golang.org/x/text/cmd/gotext (build ID mismatch)
	stale: github.com/kotakanbe/go-cve-dictionary/vendor/golang.org/x/text/cmd/gotext (build ID mismatch)
	stale: go.mozilla.org/sops/vendor/golang.org/x/text/cmd/gotext (build ID mismatch)
	up to date: golang.org/x/text/cmd/gotext
gotype
	up to date: github.com/davidrjenni/reftools/vendor/golang.org/x/tools/cmd/gotype
	up to date: golang.org/x/tools/cmd/gotype
goversion
	up to date: github.com/josharian/goversion
govet
	(no source package found)
gox
	stale: github.com/cloudflare/cfssl/vendor/github.com/mitchellh/gox (build ID mismatch)
	up to date: github.com/mitchellh/gox
goxsd
	up to date: github.com/ivarg/goxsd
goyacc
	up to date: github.com/davidrjenni/reftools/vendor/golang.org/x/tools/cmd/goyacc
	up to date: golang.org/x/tools/cmd/goyacc
gpio-list
	up to date: periph.io/x/periph/cmd/gpio-list
gpio-read
	up to date: periph.io/x/periph/cmd/gpio-read
gpio-write
	up to date: periph.io/x/periph/cmd/gpio-write
grift
	stale: github.com/klauern/adr_web/vendor/github.com/markbates/grift (build ID mismatch)
	stale: github.com/klauern/shellchecker/vendor/github.com/markbates/grift (build ID mismatch)
	up to date: github.com/markbates/grift
grv
	stale: github.com/rgburke/grv/cmd/grv (build ID mismatch)
gryffin-distributed
	up to date: github.com/yahoo/gryffin/cmd/gryffin-distributed
gryffin-standalone
	up to date: github.com/yahoo/gryffin/cmd/gryffin-standalone
guru
	stale: github.com/davidrjenni/reftools/vendor/golang.org/x/tools/cmd/guru (build ID mismatch)
	up to date: golang.org/x/tools/cmd/guru
headers-list
	up to date: periph.io/x/periph/cmd/headers-list
heapview
	up to date: github.com/davidrjenni/reftools/vendor/golang.org/x/tools/cmd/heapview
	up to date: golang.org/x/tools/cmd/heapview
html2article
	up to date: github.com/davidrjenni/reftools/vendor/golang.org/x/tools/cmd/html2article
	up to date: golang.org/x/tools/cmd/html2article
httplab
	up to date: github.com/gchaincl/httplab/cmd/httplab
hugo
	up to date: github.com/gohugoio/hugo
i2c-io
	up to date: periph.io/x/periph/cmd/i2c-io
i2c-list
	up to date: periph.io/x/periph/cmd/i2c-list
impl
	up to date: github.com/josharian/impl
ineffassign
	(no source package found)
interfacer
	(no source package found)
ir
	up to date: periph.io/x/periph/cmd/ir
joe
	up to date: github.com/karan/joe
keyify
	up to date: github.com/dominikh/go-tools/cmd/keyify
	up to date: honnef.co/go/tools/cmd/keyify
keyserver
	up to date: upspin.io/cmd/keyserver
ksuid
	up to date: github.com/segmentio/ksuid/cmd/ksuid
led
	up to date: periph.io/x/periph/cmd/led
lepton
	up to date: periph.io/x/periph/cmd/lepton
licenseok
	up to date: github.com/golang/dep/hack/licenseok
lll
	(no source package found)
maligned
	(no source package found)
mc
	stale: github.com/digitalocean/doctl/vendor/github.com/kr/text/mc (build ID mismatch)
	up to date: github.com/kr/text/mc
	stale: github.com/maruel/panicparse/vendor/github.com/kr/text/mc (build ID mismatch)
	stale: github.com/workfit/tester/vendor/github.com/kr/text/mc (build ID mismatch)
megacheck
	up to date: honnef.co/go/tools/cmd/megacheck
misspell
	(no source package found)
mmake
	up to date: github.com/tj/mmake/cmd/mmake
modd
	up to date: github.com/cortesi/modd/cmd/modd
motion
	up to date: github.com/fatih/motion
mylg
	up to date: github.com/mehrdadrad/mylg
nakedret
	(no source package found)
node-prune
	up to date: github.com/tj/node-prune/cmd/node-prune
nomad
	up to date: github.com/hashicorp/nomad
packer
	stale: github.com/hashicorp/packer (build ID mismatch)
	up to date: github.com/mitchellh/packer
passgo
	up to date: github.com/ejcx/passgo
periph-info
	up to date: periph.io/x/periph/cmd/periph-info
periph-smoketest
	up to date: periph.io/x/periph/cmd/periph-smoketest
pet
	up to date: github.com/knqyf263/pet
precommit-vet-lint
	up to date: github.com/ashwch/precommit-vet-lint
present
	stale: github.com/davidrjenni/reftools/vendor/golang.org/x/tools/cmd/present (build ID mismatch)
	up to date: golang.org/x/tools/cmd/present
primitive
	up to date: github.com/fogleman/primitive
protoc-gen-go
	stale: github.com/aybabtme/godotto/vendor/github.com/golang/protobuf/protoc-gen-go (build ID mismatch)
	stale: github.com/digitalocean/doctl/vendor/github.com/golang/protobuf/protoc-gen-go (build ID mismatch)
	up to date: github.com/golang/protobuf/protoc-gen-go
	stale: go.mozilla.org/sops/vendor/github.com/golang/protobuf/protoc-gen-go (build ID mismatch)
rdeps
	up to date: github.com/dominikh/go-tools/cmd/rdeps
	up to date: honnef.co/go/tools/cmd/rdeps
realize
	stale: github.com/tockins/realize (build ID mismatch)
refresh
	stale: github.com/klauern/adr_web/vendor/github.com/markbates/refresh (build ID mismatch)
	stale: github.com/klauern/shellchecker/vendor/github.com/markbates/refresh (build ID mismatch)
	up to date: github.com/markbates/refresh
remy
	up to date: github.com/klauern/remy/cmd/remy
richgo
	up to date: github.com/kyoh86/richgo
safesql
	(no source package found)
server_standalone
	stale: github.com/digitalocean/doctl/vendor/github.com/pkg/sftp/server_standalone (build ID mismatch)
	stale: github.com/hashicorp/packer/vendor/github.com/pkg/sftp/server_standalone (build ID mismatch)
	stale: github.com/mitchellh/packer/vendor/github.com/pkg/sftp/server_standalone (build ID mismatch)
	stale: github.com/pkg/sftp/server_standalone (stale dependency)
sftp-server
	stale: github.com/digitalocean/doctl/vendor/github.com/pkg/sftp/examples/sftp-server (build ID mismatch)
	stale: github.com/hashicorp/packer/vendor/github.com/pkg/sftp/examples/sftp-server (build ID mismatch)
	stale: github.com/mitchellh/packer/vendor/github.com/pkg/sftp/examples/sftp-server (build ID mismatch)
	stale: github.com/pkg/sftp/examples/sftp-server (stale dependency)
shawty
	up to date: github.com/didip/shawty
shfmt
	up to date: mvdan.cc/sh/cmd/shfmt
shorten
	(no source package found)
skm
	up to date: github.com/TimothyYe/skm/cmd/skm
smith
	up to date: github.com/oracle/smith
soda
	stale: github.com/klauern/adr_web/vendor/github.com/markbates/pop/soda (build ID mismatch)
	stale: github.com/klauern/shellchecker/vendor/github.com/markbates/pop/soda (build ID mismatch)
	up to date: github.com/markbates/pop/soda
sops
	up to date: go.mozilla.org/sops/cmd/sops
spi-io
	up to date: periph.io/x/periph/cmd/spi-io
spi-list
	up to date: periph.io/x/periph/cmd/spi-list
ssadump
	stale: github.com/davidrjenni/reftools/vendor/golang.org/x/tools/cmd/ssadump (build ID mismatch)
	up to date: golang.org/x/tools/cmd/ssadump
ssd1306
	up to date: periph.io/x/periph/cmd/ssd1306
staticcheck
	up to date: honnef.co/go/tools/cmd/staticcheck
storeserver
	up to date: upspin.io/cmd/storeserver
streaming-read-benchmark
	stale: github.com/digitalocean/doctl/vendor/github.com/pkg/sftp/examples/streaming-read-benchmark (build ID mismatch)
	stale: github.com/hashicorp/packer/vendor/github.com/pkg/sftp/examples/streaming-read-benchmark (build ID mismatch)
	stale: github.com/mitchellh/packer/vendor/github.com/pkg/sftp/examples/streaming-read-benchmark (build ID mismatch)
	stale: github.com/pkg/sftp/examples/streaming-read-benchmark (stale dependency)
streaming-write-benchmark
	stale: github.com/digitalocean/doctl/vendor/github.com/pkg/sftp/examples/streaming-write-benchmark (build ID mismatch)
	stale: github.com/hashicorp/packer/vendor/github.com/pkg/sftp/examples/streaming-write-benchmark (build ID mismatch)
	stale: github.com/mitchellh/packer/vendor/github.com/pkg/sftp/examples/streaming-write-benchmark (build ID mismatch)
	stale: github.com/pkg/sftp/examples/streaming-write-benchmark (stale dependency)
stress
	stale: github.com/couchbase/go_n1ql/stress (newer dependency)
	stale: github.com/davidrjenni/reftools/vendor/golang.org/x/tools/cmd/stress (build ID mismatch)
	stale: golang.org/x/release-branch.go1.4/test/stress (build ID mismatch)
	stale: golang.org/x/tools/cmd/stress (build ID mismatch)
stringer
	up to date: github.com/davidrjenni/reftools/vendor/golang.org/x/tools/cmd/stringer
	up to date: golang.org/x/tools/cmd/stringer
structcheck
	(no source package found)
structlayout
	up to date: github.com/dominikh/go-tools/cmd/structlayout
	up to date: honnef.co/go/tools/cmd/structlayout
structlayout-optimize
	up to date: github.com/dominikh/go-tools/cmd/structlayout-optimize
	up to date: honnef.co/go/tools/cmd/structlayout-optimize
structlayout-pretty
	up to date: github.com/dominikh/go-tools/cmd/structlayout-pretty
	up to date: honnef.co/go/tools/cmd/structlayout-pretty
terraform
	up to date: github.com/hashicorp/terraform
thermal
	up to date: periph.io/x/periph/cmd/thermal
tip
	up to date: github.com/davidrjenni/reftools/vendor/golang.org/x/tools/cmd/tip
	up to date: golang.org/x/tools/cmd/tip
tm1637
	up to date: periph.io/x/periph/cmd/tm1637
tomljson
	stale: github.com/go-siris/siris/vendor/github.com/pelletier/go-toml/cmd/tomljson (build ID mismatch)
	stale: github.com/klauern/adr_web/vendor/github.com/pelletier/go-toml/cmd/tomljson (build ID mismatch)
	stale: github.com/klauern/tunnellergy/vendor/github.com/pelletier/go-toml/cmd/tomljson (build ID mismatch)
	up to date: github.com/pelletier/go-toml/cmd/tomljson
tomll
	stale: github.com/go-siris/siris/vendor/github.com/pelletier/go-toml/cmd/tomll (build ID mismatch)
	stale: github.com/klauern/adr_web/vendor/github.com/pelletier/go-toml/cmd/tomll (build ID mismatch)
	stale: github.com/klauern/tunnellergy/vendor/github.com/pelletier/go-toml/cmd/tomll (build ID mismatch)
	up to date: github.com/pelletier/go-toml/cmd/tomll
toolstash
	up to date: github.com/davidrjenni/reftools/vendor/golang.org/x/tools/cmd/toolstash
	up to date: golang.org/x/tools/cmd/toolstash
trackello
	stale: github.com/klauern/trackello/cmd/trackello (build ID mismatch)
trawl
	up to date: github.com/robphoenix/trawl
tun
	up to date: github.com/klauern/tunnellergy/tun
unconvert
	(no source package found)
unparam
	(no source package found)
unused
	up to date: honnef.co/go/tools/cmd/unused
upspin
	up to date: upspin.io/cmd/upspin
upspin-deploy
	(no source package found)
upspinfs
	up to date: upspin.io/cmd/upspinfs
upspinserver
	up to date: upspin.io/cmd/upspinserver
usql
	stale: github.com/knq/usql (stale dependency)
	up to date: github.com/xo/usql
varcheck
	(no source package found)
vault
	up to date: github.com/hashicorp/vault
vg
	up to date: github.com/GetStream/vg
	stale: github.com/GetStream/vg/internal/testwrapper/vg (build ID mismatch)
vuls
	stale: github.com/future-architect/vuls (build ID mismatch)
webhook
	up to date: github.com/adnanh/webhook
wls-resources
	stale: github.com/klauern/wls-resources (build ID mismatch)
wuzz
	up to date: github.com/asciimoo/wuzz
xorm
	up to date: github.com/go-xorm/cmd/xorm
xsd-makepkg
	up to date: github.com/metaleap/go-xsd/xsd-makepkg
xsd-test-atom
	stale: github.com/metaleap/go-xsd/xsd-makepkg/tests/xsd-test-atom (build ID mismatch)
xsd-test-collada
	stale: github.com/metaleap/go-xsd/xsd-makepkg/tests/xsd-test-collada (build ID mismatch)
xsd-test-kml
	stale: github.com/metaleap/go-xsd/xsd-makepkg/tests/xsd-test-kml (build ID mismatch)
xsd-test-rss
	stale: github.com/metaleap/go-xsd/xsd-makepkg/tests/xsd-test-rss (build ID mismatch)
xsd-test-svg
	up to date: github.com/metaleap/go-xsd/xsd-makepkg/tests/xsd-test-svg
yags
	up to date: github.com/pltanton/yags
zb
	up to date: jrubin.io/zb
github.com/shurcooL/Go-Package-Store/cmd/Go-Package-Store
github.com/FiloSottile/Heartbleed
github.com/kr/text/cmd/agg
github.com/maruel/panicparse/vendor/github.com/kr/text/cmd/agg
github.com/workfit/tester/vendor/github.com/kr/text/cmd/agg
periph.io/x/periph/cmd/apa102
github.com/klauspost/asmfmt/cmd/asmfmt
github.com/awslabs/aws-sam-local
github.com/dave/rebecca/cmd/becca
github.com/davelondon/rebecca/cmd/becca
golang.org/x/tools/cmd/benchcmp
github.com/shurcooL/binstale
golang.org/x/tools/cmd/bundle
upspin.io/cmd/cacheserver
github.com/mholt/caddy/caddy
golang.org/x/tools/cmd/callgraph
github.com/square/certigo
github.com/cloudflare/cfssl/cmd/cfssl
github.com/gnewton/chidley
github.com/pelletier/go-toml/cmd
github.com/asciimoo/coa
github.com/spf13/cobra/cobra
golang.org/x/text/collate/tools/colcmp
golang.org/x/tools/cmd/cover
github.com/golang/dep/cmd/dep
github.com/davidrjenni/reftools/vendor/golang.org/x/tools/cmd/digraph
golang.org/x/tools/cmd/digraph
upspin.io/cmd/dirserver
github.com/derekparker/delve/cmd/dlv
github.com/docker/cli/cmd/docker
github.com/aybabtme/godotto/cmd/dorepl
golang.org/x/tools/cmd/eg
github.com/kisielk/errcheck
github.com/mkchoi212/fac
github.com/davidrjenni/reftools/cmd/fillstruct
github.com/davidrjenni/reftools/vendor/golang.org/x/tools/cmd/fiximports
golang.org/x/tools/cmd/fiximports
upspin.io/cmd/frontend
github.com/constabulary/gb/cmd/gb
github.com/aarzilli/gdlv
github.com/onsi/ginkgo/ginkgo
golang.org/x/review/git-codereview
github.com/Masterminds/glide
github.com/jteeuwen/go-bindata/go-bindata
github.com/metaleap/go-buildrun
github.com/sourcegraph/go-langserver
github.com/lukehoban/go-outline
github.com/d4l3k/go-pry
github.com/acroca/go-symbols
github.com/newhook/go-symbols
golang.org/x/build/version/go1.8rc2
github.com/nsf/gocode
github.com/posener/complete/gocomplete
github.com/smartystreets/goconvey
github.com/rogpeppe/godef
github.com/kisielk/godepgraph
github.com/davidrjenni/reftools/vendor/golang.org/x/tools/cmd/godex
golang.org/x/tools/cmd/godex
golang.org/x/tools/cmd/godoc
github.com/godoctor/godoctor
github.com/zmb3/gogetdoc
github.com/Gnouc/gogi/cmd/gogi
github.com/gogits/gogs
golang.org/x/tools/cmd/goimports
github.com/360EntSecGroup-Skylar/goreporter/linters/golint/golint
github.com/golang/lint/golint
github.com/wgliang/goreporter/linters/golint/golint
github.com/christophberger/goman
github.com/alecthomas/gometalinter
github.com/fatih/gomodifytags
golang.org/x/tools/cmd/gomvpkg
github.com/justwatchcom/gopass
github.com/gopherjs/gopherjs
github.com/uudashr/gopkgs/cmd/gopkgs
github.com/haya14busa/goplay/cmd/goplay
github.com/motemen/gore
github.com/FiloSottile/gorebuild
github.com/goreleaser/goreleaser
golang.org/x/tools/cmd/gorename
github.com/360EntSecGroup-Skylar/goreporter
github.com/wgliang/goreporter
github.com/sqs/goreturns
sourcegraph.com/sqs/goreturns
honnef.co/go/tools/cmd/gosimple
github.com/shurcooL/gostatus
github.com/jstemmer/gotags
github.com/cweill/gotests/gotests
golang.org/x/text/cmd/gotext
github.com/davidrjenni/reftools/vendor/golang.org/x/tools/cmd/gotype
golang.org/x/tools/cmd/gotype
github.com/josharian/goversion
github.com/mitchellh/gox
github.com/ivarg/goxsd
github.com/davidrjenni/reftools/vendor/golang.org/x/tools/cmd/goyacc
golang.org/x/tools/cmd/goyacc
periph.io/x/periph/cmd/gpio-list
periph.io/x/periph/cmd/gpio-read
periph.io/x/periph/cmd/gpio-write
github.com/markbates/grift
github.com/yahoo/gryffin/cmd/gryffin-distributed
github.com/yahoo/gryffin/cmd/gryffin-standalone
golang.org/x/tools/cmd/guru
periph.io/x/periph/cmd/headers-list
github.com/davidrjenni/reftools/vendor/golang.org/x/tools/cmd/heapview
golang.org/x/tools/cmd/heapview
github.com/davidrjenni/reftools/vendor/golang.org/x/tools/cmd/html2article
golang.org/x/tools/cmd/html2article
github.com/gchaincl/httplab/cmd/httplab
github.com/gohugoio/hugo
periph.io/x/periph/cmd/i2c-io
periph.io/x/periph/cmd/i2c-list
github.com/josharian/impl
periph.io/x/periph/cmd/ir
github.com/karan/joe
github.com/dominikh/go-tools/cmd/keyify
honnef.co/go/tools/cmd/keyify
upspin.io/cmd/keyserver
github.com/segmentio/ksuid/cmd/ksuid
periph.io/x/periph/cmd/led
periph.io/x/periph/cmd/lepton
github.com/golang/dep/hack/licenseok
github.com/kr/text/mc
honnef.co/go/tools/cmd/megacheck
github.com/tj/mmake/cmd/mmake
github.com/cortesi/modd/cmd/modd
github.com/fatih/motion
github.com/mehrdadrad/mylg
github.com/tj/node-prune/cmd/node-prune
github.com/hashicorp/nomad
github.com/mitchellh/packer
github.com/ejcx/passgo
periph.io/x/periph/cmd/periph-info
periph.io/x/periph/cmd/periph-smoketest
github.com/knqyf263/pet
github.com/ashwch/precommit-vet-lint
golang.org/x/tools/cmd/present
github.com/fogleman/primitive
github.com/golang/protobuf/protoc-gen-go
github.com/dominikh/go-tools/cmd/rdeps
honnef.co/go/tools/cmd/rdeps
github.com/markbates/refresh
github.com/klauern/remy/cmd/remy
github.com/kyoh86/richgo
github.com/didip/shawty
mvdan.cc/sh/cmd/shfmt
github.com/TimothyYe/skm/cmd/skm
github.com/oracle/smith
github.com/markbates/pop/soda
go.mozilla.org/sops/cmd/sops
periph.io/x/periph/cmd/spi-io
periph.io/x/periph/cmd/spi-list
golang.org/x/tools/cmd/ssadump
periph.io/x/periph/cmd/ssd1306
honnef.co/go/tools/cmd/staticcheck
upspin.io/cmd/storeserver
github.com/davidrjenni/reftools/vendor/golang.org/x/tools/cmd/stringer
golang.org/x/tools/cmd/stringer
github.com/dominikh/go-tools/cmd/structlayout
honnef.co/go/tools/cmd/structlayout
github.com/dominikh/go-tools/cmd/structlayout-optimize
honnef.co/go/tools/cmd/structlayout-optimize
github.com/dominikh/go-tools/cmd/structlayout-pretty
honnef.co/go/tools/cmd/structlayout-pretty
github.com/hashicorp/terraform
periph.io/x/periph/cmd/thermal
github.com/davidrjenni/reftools/vendor/golang.org/x/tools/cmd/tip
golang.org/x/tools/cmd/tip
periph.io/x/periph/cmd/tm1637
github.com/pelletier/go-toml/cmd/tomljson
github.com/pelletier/go-toml/cmd/tomll
github.com/davidrjenni/reftools/vendor/golang.org/x/tools/cmd/toolstash
golang.org/x/tools/cmd/toolstash
github.com/robphoenix/trawl
github.com/klauern/tunnellergy/tun
honnef.co/go/tools/cmd/unused
upspin.io/cmd/upspin
upspin.io/cmd/upspinfs
upspin.io/cmd/upspinserver
github.com/xo/usql
github.com/hashicorp/vault
github.com/GetStream/vg
github.com/adnanh/webhook
github.com/asciimoo/wuzz
github.com/go-xorm/cmd/xorm
github.com/metaleap/go-xsd/xsd-makepkg
github.com/metaleap/go-xsd/xsd-makepkg/tests/xsd-test-svg
github.com/pltanton/yags
jrubin.io/zb
	stale: github.com/mholt/archiver/cmd/archiver (stale dependency)
binstale
	up to date: github.com/shurcooL/binstale
	stale: github.com/gobuffalo/buffalo/buffalo (build ID mismatch)
	stale: github.com/pkg/sftp/examples/buffered-read-benchmark (stale dependency)
	stale: github.com/pkg/sftp/examples/buffered-write-benchmark (stale dependency)
	stale: cloud.google.com/go/pubsub/loadtest/cmd (build ID mismatch)
	stale: github.com/Azure/go-autorest/autorest/adal/cmd (build ID mismatch)
	stale: github.com/derekparker/delve/service/test/cmd (build ID mismatch)
	stale: github.com/docker/docker-credential-helpers/pass/cmd (build ID mismatch)
	stale: github.com/docker/docker-credential-helpers/secretservice/cmd (build ID mismatch)
	stale: github.com/docker/machine/cmd (build ID mismatch)
	stale: github.com/klauern/osb-lint/cmd (build ID mismatch)
	stale: github.com/klauern/rollin_dollas/cmd (build ID mismatch)
	stale: github.com/marshallbrekka/go-u2fhost/cmd (build ID mismatch)
	stale: github.com/klauern/coke (build ID mismatch)
	stale: github.com/gilbertchen/duplicacy/duplicacy (build ID mismatch)
	stale: github.com/shurcooL/Go-Package-Store/frontend (build ID mismatch)
	stale: github.com/kotakanbe/go-cve-dictionary (build ID mismatch)
	stale: github.com/ramya-rao-a/go-outline (build ID mismatch)
	stale: github.com/klauspost/asmfmt/cmd/goimports (build ID mismatch)
	stale: github.com/bradleyfalzon/gopherci (build ID mismatch)
	stale: github.com/haya14busa/gopkgs/cmd/gopkgs (build ID mismatch)
	stale: github.com/tpng/gopkgs (build ID mismatch)
	stale: github.com/klauspost/asmfmt/cmd/goreturns (build ID mismatch)
	stale: github.com/rgburke/grv/cmd/grv (build ID mismatch)
	stale: github.com/hashicorp/packer (build ID mismatch)
	stale: github.com/tockins/realize (build ID mismatch)
	stale: github.com/pkg/sftp/server_standalone (stale dependency)
	stale: github.com/pkg/sftp/examples/sftp-server (stale dependency)
	stale: github.com/pkg/sftp/examples/streaming-read-benchmark (stale dependency)
	stale: github.com/pkg/sftp/examples/streaming-write-benchmark (stale dependency)
	stale: github.com/couchbase/go_n1ql/stress (newer dependency)
	stale: golang.org/x/release-branch.go1.4/test/stress (build ID mismatch)
	stale: golang.org/x/tools/cmd/stress (build ID mismatch)
	stale: github.com/klauern/trackello/cmd/trackello (build ID mismatch)
	stale: github.com/knq/usql (stale dependency)
	stale: github.com/GetStream/vg/internal/testwrapper/vg (build ID mismatch)
	stale: github.com/future-architect/vuls (build ID mismatch)
	stale: github.com/klauern/wls-resources (build ID mismatch)
	stale: github.com/metaleap/go-xsd/xsd-makepkg/tests/xsd-test-atom (build ID mismatch)
	stale: github.com/metaleap/go-xsd/xsd-makepkg/tests/xsd-test-collada (build ID mismatch)
	stale: github.com/metaleap/go-xsd/xsd-makepkg/tests/xsd-test-kml (build ID mismatch)
	stale: github.com/metaleap/go-xsd/xsd-makepkg/tests/xsd-test-rss (build ID mismatch)
github.com/shurcooL/Go-Package-Store/cmd/Go-Package-Store
github.com/FiloSottile/Heartbleed
github.com/kr/text/cmd/agg
github.com/maruel/panicparse/vendor/github.com/kr/text/cmd/agg
github.com/workfit/tester/vendor/github.com/kr/text/cmd/agg
periph.io/x/periph/cmd/apa102
github.com/klauspost/asmfmt/cmd/asmfmt
github.com/awslabs/aws-sam-local
github.com/dave/rebecca/cmd/becca
github.com/davelondon/rebecca/cmd/becca
golang.org/x/tools/cmd/benchcmp
github.com/shurcooL/binstale
golang.org/x/tools/cmd/bundle
upspin.io/cmd/cacheserver
github.com/mholt/caddy/caddy
golang.org/x/tools/cmd/callgraph
github.com/square/certigo
github.com/cloudflare/cfssl/cmd/cfssl
github.com/gnewton/chidley
github.com/pelletier/go-toml/cmd
github.com/asciimoo/coa
github.com/spf13/cobra/cobra
golang.org/x/text/collate/tools/colcmp
golang.org/x/tools/cmd/cover
github.com/golang/dep/cmd/dep
github.com/davidrjenni/reftools/vendor/golang.org/x/tools/cmd/digraph
golang.org/x/tools/cmd/digraph
upspin.io/cmd/dirserver
github.com/derekparker/delve/cmd/dlv
github.com/docker/cli/cmd/docker
github.com/aybabtme/godotto/cmd/dorepl
golang.org/x/tools/cmd/eg
github.com/kisielk/errcheck
github.com/mkchoi212/fac
github.com/davidrjenni/reftools/cmd/fillstruct
github.com/davidrjenni/reftools/vendor/golang.org/x/tools/cmd/fiximports
golang.org/x/tools/cmd/fiximports
upspin.io/cmd/frontend
github.com/constabulary/gb/cmd/gb
github.com/aarzilli/gdlv
github.com/onsi/ginkgo/ginkgo
golang.org/x/review/git-codereview
github.com/Masterminds/glide
github.com/jteeuwen/go-bindata/go-bindata
github.com/metaleap/go-buildrun
github.com/sourcegraph/go-langserver
github.com/lukehoban/go-outline
github.com/d4l3k/go-pry
github.com/acroca/go-symbols
github.com/newhook/go-symbols
golang.org/x/build/version/go1.8rc2
github.com/nsf/gocode
github.com/posener/complete/gocomplete
github.com/smartystreets/goconvey
github.com/rogpeppe/godef
github.com/kisielk/godepgraph
github.com/davidrjenni/reftools/vendor/golang.org/x/tools/cmd/godex
golang.org/x/tools/cmd/godex
golang.org/x/tools/cmd/godoc
github.com/godoctor/godoctor
github.com/zmb3/gogetdoc
github.com/Gnouc/gogi/cmd/gogi
github.com/gogits/gogs
golang.org/x/tools/cmd/goimports
github.com/360EntSecGroup-Skylar/goreporter/linters/golint/golint
github.com/golang/lint/golint
github.com/wgliang/goreporter/linters/golint/golint
github.com/christophberger/goman
github.com/alecthomas/gometalinter
github.com/fatih/gomodifytags
golang.org/x/tools/cmd/gomvpkg
github.com/justwatchcom/gopass
github.com/gopherjs/gopherjs
github.com/uudashr/gopkgs/cmd/gopkgs
github.com/haya14busa/goplay/cmd/goplay
github.com/motemen/gore
github.com/FiloSottile/gorebuild
github.com/goreleaser/goreleaser
golang.org/x/tools/cmd/gorename
github.com/360EntSecGroup-Skylar/goreporter
github.com/wgliang/goreporter
github.com/sqs/goreturns
sourcegraph.com/sqs/goreturns
honnef.co/go/tools/cmd/gosimple
github.com/shurcooL/gostatus
github.com/jstemmer/gotags
github.com/cweill/gotests/gotests
golang.org/x/text/cmd/gotext
github.com/davidrjenni/reftools/vendor/golang.org/x/tools/cmd/gotype
golang.org/x/tools/cmd/gotype
github.com/josharian/goversion
github.com/mitchellh/gox
github.com/ivarg/goxsd
github.com/davidrjenni/reftools/vendor/golang.org/x/tools/cmd/goyacc
golang.org/x/tools/cmd/goyacc
periph.io/x/periph/cmd/gpio-list
periph.io/x/periph/cmd/gpio-read
periph.io/x/periph/cmd/gpio-write
github.com/markbates/grift
github.com/yahoo/gryffin/cmd/gryffin-distributed
github.com/yahoo/gryffin/cmd/gryffin-standalone
golang.org/x/tools/cmd/guru
periph.io/x/periph/cmd/headers-list
github.com/davidrjenni/reftools/vendor/golang.org/x/tools/cmd/heapview
golang.org/x/tools/cmd/heapview
github.com/davidrjenni/reftools/vendor/golang.org/x/tools/cmd/html2article
golang.org/x/tools/cmd/html2article
github.com/gchaincl/httplab/cmd/httplab
github.com/gohugoio/hugo
periph.io/x/periph/cmd/i2c-io
periph.io/x/periph/cmd/i2c-list
github.com/josharian/impl
periph.io/x/periph/cmd/ir
github.com/karan/joe
github.com/dominikh/go-tools/cmd/keyify
honnef.co/go/tools/cmd/keyify
upspin.io/cmd/keyserver
github.com/segmentio/ksuid/cmd/ksuid
periph.io/x/periph/cmd/led
periph.io/x/periph/cmd/lepton
github.com/golang/dep/hack/licenseok
github.com/kr/text/mc
honnef.co/go/tools/cmd/megacheck
github.com/tj/mmake/cmd/mmake
github.com/cortesi/modd/cmd/modd
github.com/fatih/motion
github.com/mehrdadrad/mylg
github.com/tj/node-prune/cmd/node-prune
github.com/hashicorp/nomad
github.com/mitchellh/packer
github.com/ejcx/passgo
periph.io/x/periph/cmd/periph-info
periph.io/x/periph/cmd/periph-smoketest
github.com/knqyf263/pet
github.com/ashwch/precommit-vet-lint
golang.org/x/tools/cmd/present
github.com/fogleman/primitive
github.com/golang/protobuf/protoc-gen-go
github.com/dominikh/go-tools/cmd/rdeps
honnef.co/go/tools/cmd/rdeps
github.com/markbates/refresh
github.com/klauern/remy/cmd/remy
github.com/kyoh86/richgo
github.com/didip/shawty
mvdan.cc/sh/cmd/shfmt
github.com/TimothyYe/skm/cmd/skm
github.com/oracle/smith
github.com/markbates/pop/soda
go.mozilla.org/sops/cmd/sops
periph.io/x/periph/cmd/spi-io
periph.io/x/periph/cmd/spi-list
golang.org/x/tools/cmd/ssadump
periph.io/x/periph/cmd/ssd1306
honnef.co/go/tools/cmd/staticcheck
upspin.io/cmd/storeserver
github.com/davidrjenni/reftools/vendor/golang.org/x/tools/cmd/stringer
golang.org/x/tools/cmd/stringer
github.com/dominikh/go-tools/cmd/structlayout
honnef.co/go/tools/cmd/structlayout
github.com/dominikh/go-tools/cmd/structlayout-optimize
honnef.co/go/tools/cmd/structlayout-optimize
github.com/dominikh/go-tools/cmd/structlayout-pretty
honnef.co/go/tools/cmd/structlayout-pretty
github.com/hashicorp/terraform
periph.io/x/periph/cmd/thermal
github.com/davidrjenni/reftools/vendor/golang.org/x/tools/cmd/tip
golang.org/x/tools/cmd/tip
periph.io/x/periph/cmd/tm1637
github.com/pelletier/go-toml/cmd/tomljson
github.com/pelletier/go-toml/cmd/tomll
github.com/davidrjenni/reftools/vendor/golang.org/x/tools/cmd/toolstash
golang.org/x/tools/cmd/toolstash
github.com/robphoenix/trawl
github.com/klauern/tunnellergy/tun
honnef.co/go/tools/cmd/unused
upspin.io/cmd/upspin
upspin.io/cmd/upspinfs
upspin.io/cmd/upspinserver
github.com/xo/usql
github.com/hashicorp/vault
github.com/GetStream/vg
github.com/adnanh/webhook
github.com/asciimoo/wuzz
github.com/go-xorm/cmd/xorm
github.com/metaleap/go-xsd/xsd-makepkg
github.com/metaleap/go-xsd/xsd-makepkg/tests/xsd-test-svg
github.com/pltanton/yags
jrubin.io/zb
github.com/mholt/archiver/cmd/archiver
github.com/davidrjenni/reftools/vendor/golang.org/x/tools/cmd/benchcmp
to
github.com/gobuffalo/buffalo/buffalo
github.com/klauern/adr_web/vendor/github.com/gobuffalo/buffalo/buffalo
github.com/klauern/shellchecker/vendor/github.com/gobuffalo/buffalo/buffalo
github.com/digitalocean/doctl/vendor/github.com/pkg/sftp/examples/buffered-read-benchmark
github.com/hashicorp/packer/vendor/github.com/pkg/sftp/examples/buffered-read-benchmark
github.com/mitchellh/packer/vendor/github.com/pkg/sftp/examples/buffered-read-benchmark
github.com/pkg/sftp/examples/buffered-read-benchmark
github.com/digitalocean/doctl/vendor/github.com/pkg/sftp/examples/buffered-write-benchmark
github.com/hashicorp/packer/vendor/github.com/pkg/sftp/examples/buffered-write-benchmark
github.com/mitchellh/packer/vendor/github.com/pkg/sftp/examples/buffered-write-benchmark
github.com/pkg/sftp/examples/buffered-write-benchmark
github.com/davidrjenni/reftools/vendor/golang.org/x/tools/cmd/bundle
github.com/davidrjenni/reftools/vendor/golang.org/x/tools/cmd/callgraph
cloud.google.com/go/pubsub/loadtest/cmd
github.com/Azure/go-autorest/autorest/adal/cmd
github.com/derekparker/delve/service/test/cmd
github.com/docker/docker-credential-helpers/pass/cmd
github.com/docker/docker-credential-helpers/secretservice/cmd
github.com/docker/machine/cmd
github.com/go-siris/siris/vendor/github.com/pelletier/go-toml/cmd
github.com/klauern/adr_web/vendor/github.com/pelletier/go-toml/cmd
github.com/klauern/osb-lint/cmd
github.com/klauern/rollin_dollas/cmd
github.com/klauern/tunnellergy/vendor/github.com/pelletier/go-toml/cmd
github.com/marshallbrekka/go-u2fhost/cmd
go.mozilla.org/sops/vendor/cloud.google.com/go/pubsub/loadtest/cmd
github.com/digitalocean/doctl/vendor/github.com/spf13/cobra/cobra
github.com/klauern/tunnellergy/vendor/github.com/spf13/cobra/cobra
github.com/klauern/coke
github.com/digitalocean/doctl/vendor/golang.org/x/text/collate/tools/colcmp
github.com/go-siris/siris/vendor/golang.org/x/text/collate/tools/colcmp
github.com/klauern/tunnellergy/vendor/golang.org/x/text/collate/tools/colcmp
github.com/kotakanbe/go-cve-dictionary/vendor/golang.org/x/text/collate/tools/colcmp
go.mozilla.org/sops/vendor/golang.org/x/text/collate/tools/colcmp
github.com/davidrjenni/reftools/vendor/golang.org/x/tools/cmd/cover
github.com/klauern/oldgojenkins/vendor/github.com/docker/docker/cmd/docker
github.com/klauern/oldgojenkins/vendor/github.com/moby/moby/cmd/docker
github.com/gilbertchen/duplicacy/duplicacy
github.com/davidrjenni/reftools/vendor/golang.org/x/tools/cmd/eg
github.com/shurcooL/Go-Package-Store/frontend
github.com/constabulary/gb/cmd/gb-vendor
go.mozilla.org/sops/vendor/github.com/onsi/ginkgo/ginkgo
github.com/kotakanbe/go-cve-dictionary
github.com/ramya-rao-a/go-outline
go.mozilla.org/sops/vendor/github.com/smartystreets/goconvey
github.com/davidrjenni/reftools/vendor/golang.org/x/tools/cmd/godoc
github.com/davidrjenni/reftools/vendor/golang.org/x/tools/cmd/goimports
github.com/klauspost/asmfmt/cmd/goimports
github.com/davidrjenni/reftools/vendor/golang.org/x/tools/cmd/gomvpkg
github.com/bradleyfalzon/gopherci
go.mozilla.org/sops/vendor/github.com/gopherjs/gopherjs
github.com/haya14busa/gopkgs/cmd/gopkgs
github.com/tpng/gopkgs
github.com/davidrjenni/reftools/vendor/golang.org/x/tools/cmd/gorename
github.com/klauspost/asmfmt/cmd/goreturns
github.com/go-siris/siris/vendor/golang.org/x/text/cmd/gotext
github.com/klauern/tunnellergy/vendor/golang.org/x/text/cmd/gotext
github.com/kotakanbe/go-cve-dictionary/vendor/golang.org/x/text/cmd/gotext
go.mozilla.org/sops/vendor/golang.org/x/text/cmd/gotext
github.com/cloudflare/cfssl/vendor/github.com/mitchellh/gox
github.com/klauern/adr_web/vendor/github.com/markbates/grift
github.com/klauern/shellchecker/vendor/github.com/markbates/grift
github.com/rgburke/grv/cmd/grv
github.com/davidrjenni/reftools/vendor/golang.org/x/tools/cmd/guru
github.com/digitalocean/doctl/vendor/github.com/kr/text/mc
github.com/maruel/panicparse/vendor/github.com/kr/text/mc
github.com/workfit/tester/vendor/github.com/kr/text/mc
github.com/hashicorp/packer
github.com/davidrjenni/reftools/vendor/golang.org/x/tools/cmd/present
github.com/aybabtme/godotto/vendor/github.com/golang/protobuf/protoc-gen-go
github.com/digitalocean/doctl/vendor/github.com/golang/protobuf/protoc-gen-go
go.mozilla.org/sops/vendor/github.com/golang/protobuf/protoc-gen-go
github.com/tockins/realize
github.com/klauern/adr_web/vendor/github.com/markbates/refresh
github.com/klauern/shellchecker/vendor/github.com/markbates/refresh
github.com/digitalocean/doctl/vendor/github.com/pkg/sftp/server_standalone
github.com/hashicorp/packer/vendor/github.com/pkg/sftp/server_standalone
github.com/mitchellh/packer/vendor/github.com/pkg/sftp/server_standalone
github.com/pkg/sftp/server_standalone
github.com/digitalocean/doctl/vendor/github.com/pkg/sftp/examples/sftp-server
github.com/hashicorp/packer/vendor/github.com/pkg/sftp/examples/sftp-server
github.com/mitchellh/packer/vendor/github.com/pkg/sftp/examples/sftp-server
github.com/pkg/sftp/examples/sftp-server
github.com/klauern/adr_web/vendor/github.com/markbates/pop/soda
github.com/klauern/shellchecker/vendor/github.com/markbates/pop/soda
github.com/davidrjenni/reftools/vendor/golang.org/x/tools/cmd/ssadump
github.com/digitalocean/doctl/vendor/github.com/pkg/sftp/examples/streaming-read-benchmark
github.com/hashicorp/packer/vendor/github.com/pkg/sftp/examples/streaming-read-benchmark
github.com/mitchellh/packer/vendor/github.com/pkg/sftp/examples/streaming-read-benchmark
github.com/pkg/sftp/examples/streaming-read-benchmark
github.com/digitalocean/doctl/vendor/github.com/pkg/sftp/examples/streaming-write-benchmark
github.com/hashicorp/packer/vendor/github.com/pkg/sftp/examples/streaming-write-benchmark
github.com/mitchellh/packer/vendor/github.com/pkg/sftp/examples/streaming-write-benchmark
github.com/pkg/sftp/examples/streaming-write-benchmark
github.com/couchbase/go_n1ql/stress
github.com/davidrjenni/reftools/vendor/golang.org/x/tools/cmd/stress
golang.org/x/release-branch.go1.4/test/stress
golang.org/x/tools/cmd/stress
github.com/go-siris/siris/vendor/github.com/pelletier/go-toml/cmd/tomljson
github.com/klauern/adr_web/vendor/github.com/pelletier/go-toml/cmd/tomljson
github.com/klauern/tunnellergy/vendor/github.com/pelletier/go-toml/cmd/tomljson
github.com/go-siris/siris/vendor/github.com/pelletier/go-toml/cmd/tomll
github.com/klauern/adr_web/vendor/github.com/pelletier/go-toml/cmd/tomll
github.com/klauern/tunnellergy/vendor/github.com/pelletier/go-toml/cmd/tomll
github.com/klauern/trackello/cmd/trackello
github.com/knq/usql
github.com/GetStream/vg/internal/testwrapper/vg
github.com/future-architect/vuls
github.com/klauern/wls-resources
github.com/metaleap/go-xsd/xsd-makepkg/tests/xsd-test-atom
github.com/metaleap/go-xsd/xsd-makepkg/tests/xsd-test-collada
github.com/metaleap/go-xsd/xsd-makepkg/tests/xsd-test-kml
github.com/metaleap/go-xsd/xsd-makepkg/tests/xsd-test-rss